Copy Link Print Information

GH/Somatotropin Protein, Mouse

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GH/Somatotropin Protein, Mouse
  • Experimental Validation Results for GH/Somatotropin Protein, Mouse
  • GH/Somatotropin Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.

Background

Growth Hormone (Somatotropin) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children[1]. Growth Hormone is a stress hormone that stimulates production of IGF-1 and raises the concentration of glucose and free fatty acids[2]. Growth Hormone exerts some of its effects by binding to receptors on target cells, where it activates the MAPK/ERK pathway[3].

Verified Bioactivity

1.Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is ≤0.1051 ng/mL, corresponding to a specific activity is ≥9.515×106 U/mg.
2.Immobilized Recombinant Mouse GHR (C-Fc) at 2 μg/mL (100 μL/well) can bind Recombinant Mouse GH. Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse GH is 1.0-5.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.1051 ng/mL, corresponding to a specific activity is 9.515×106 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P06880 (F27-F216)

  • Gene ID
    14599  [NCBI]
  • Molecular Construction
    • N-term
    • GH (F27-F216)
      Accession # P06880
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GH1; Growth Hormone 1 Variant 2; Growth Hormone 1; Growth Hormone 1 Variant 1; GH-N; Growth Hormone 1 Isoform 1; GH; HCG1749481, Isoform CRA_aa; Pituitary Growth Hormone; Growth Hormone 1 Isoform 2; Somatotropin; HCG1749481, Isoform CRA_s; HGH-N; HCG17494

  • AA Sequence

    FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 4% sucrose, 4% mannitol, 0.02% Tween 80, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, pH 8.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Takeda A, et al. Recombinant human growth hormone for the treatment of growth disorders in children: a systematic review and economic evaluation. Health Technol Assess. 2010 Sep;14(42):1-209, iii-iv. [Content Brief]

[2]. Ranabir S, et al. Stress and hormones. Indian J Endocrinol Metab. 2011 Jan;15(1):18-22. [Content Brief]

[3]. Binder G, et al. "Noonan Syndrome: Genetics and Responsiveness to Growth Hormone Therapy". Horm Res. 67 (Supplement 1): 45-49.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.1051 ng/mL, corresponding to a specific activity is 9.515×106 U/mg.

  • GH/Somatotropin Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for GH/Somatotropin Protein, Mouse
  • Experimental Validation Results for GH/Somatotropin Protein, Mouse
  • GH/Somatotropin Protein, Mouse Product Image