GMP IL-12 Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A heterodimerizes with IL-12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine. GMP IL-12 Protein, Human (HEK293), a recombinant GMP-grade protein,  is produced in HEK293 cells. It consists of IL-12A and IL-12B.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A heterodimerizes with IL-12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine[1][2]. GMP IL-12 Protein, Human (HEK293), a recombinant GMP-grade protein,  is produced in HEK293 cells. It consists of IL-12A and IL-12B.

Background

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes, induces the production of IFN-gamma, favors the differentiation of Th1 cells and is an important link between innate resistance and adaptive immunity[1][2].
The amino acid sequence of human IL-12A protein has low homology between mouse IL-12A protein. While, human IL-12A shares 94% aa sequence identity with Rhesus Macaque IL-12A protein.
IL-12 family cytokines are pleiotropic immunological playmakers that coordinate innate and adaptive immune responses mainly via regulation of T-cell populations. The four core members of the Interleukin-12 (IL-12) family of cytokines, IL-12, IL-23, IL-27 and IL-35 are heterodimers which share α-cytokine subunits (IL-12p35 (IL-12A), IL-23p19, and IL-27p28) and β-cytokine subunits (IL-12p40, Ebi3). The subunits are each encoded by separate chromosomes and their expression is regulated independently. Among them, the IL-12A subunit has immunoregulatory functions hitherto attributed to IL-35. Pairing of the α-subunits, IL-12A or IL-23p19 with IL-12p40, gives rise to the two pro-inflammatory members IL-12 and IL-23, respectively, whereas the two immunosuppressive members of the family, IL-27 and IL-35, derive from pairing of IL-27p28 or IL-12A with Ebi3[1][2].
IL-12A suppresses lymphocyte proliferation, induces expansion of IL-10-expressing and IL-35-expressing B cells and ameliorates autoimmune uveitis in mice by antagonizing pathogenic Th17 responses. IL-12A-mediated expansion of Treg and Breg cells and its amelioration of experimental autoimmune encephalomyelitis (EAE) correlated with inhibition of cytokine-induced activation of STAT1/STAT3 pathways. IL-12A may be utilized for in vivo expansion of Tregs and Bregs cells and autologous Tregs and Bregs cell immunotherapy[1][2].

In Vitro

IL-12 Protein, Human (10 ng/mL; for 5 days) results in the induction of IFN-γ secretion by Dermatophagoides pteronyssinus group 1 antigen (Der p 1)-specific CD4+ T cells in dendritic cell (DC)-T cell cocultures, whereas their production of IL-5 is not inhibited[3].

Verified Bioactivity

Immobilized Human IL-12RB1-His at 10 μg/mL (100 μl/well)can bind Human IL-12*: Biotinylated by NHS-biotin prior to testing. The ED50 for this effect is 7 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL12A (R23-S219)
      Accession # P29459
    • C-term
    • N-term
    • P29460 IL12B (I23-S328)
      Accession #
    • C-term
  • Synonyms

    IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte

  • AA Sequence

    RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
    &:
    IWELKKDVYVVELDWYPDAPGEMVVLTCDTPE

  • Predicted Molecular Mass

    22.5 kDa & 34.7 kDa

  • Molecular Weight

    Approximately 25-38 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00