Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Customer Review

Based on 1 Customer Validation

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-independent phospholipase and O-acyltransferase activities, potentially contributing to glycerophospholipid homeostasis and the remodeling of acyl groups in acidic cellular compartments. The enzyme catalyzes the hydrolysis of the ester bond of the fatty acyl group at sn-1 or sn-2 positions of phospholipids, demonstrating both phospholipase A1 and A2 activities, and transfers it to the hydroxyl group at the first carbon of lipophilic alcohols through O-acyltransferase activity. Pla2g15 prefers fatty acyl donors such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, and phosphatidylserines, favoring sn-2 over sn-1 deacylation of unsaturated fatty acyl groups. Additionally, it selectively hydrolyzes the sn-1 fatty acyl group of truncated oxidized phospholipids, potentially participating in the detoxification of reactive oxidized phospholipids during oxidative stress. Pla2g15 plays a vital role in phospholipid degradation in alveolar macrophages, suggesting implications in pulmonary surfactant clearance. At neutral pH, it hydrolyzes the sn-1 fatty acyl group of lysophosphatidylcholines.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • Pla2g15 (A34-P412)
      Accession # Q8VEB4
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLA2G15; 1-O-Acylceramide Synthase; Prev. LYPLA3; LPLA2; LLPL; ACS; GXVPLA2; CDNA FLJ57757, Highly Similar To 1-O-Acylceramide Synthase; Lysophospholipase 3 (Lysosomal Phospholipase A2); CDNA FLJ58003, Highly Similar To 1-O-Acylceramide Synthase; Lysosoma

  • AA Sequence

    AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

  • Predicted Molecular Mass

    50.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00