IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc)

IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived IFN-gamma R1/CD119 protein, expressed by HEK293, with C-hFc tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived IFN-gamma R1/CD119 protein, expressed by HEK293, with C-hFc tag.

Background

IFN-gamma R1 (CD119) serves as the receptor subunit for interferon gamma (IFNG), playing pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Teaming up with the transmembrane accessory factor IFNGR2, IFNGR1 forms a functional receptor complex. Upon IFNG binding, the intracellular domain of IFNGR1 undergoes conformational changes, allowing the association of downstream signaling components, including JAK1 and JAK2. Activated JAK1 phosphorylates IFNGR1, creating a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription. IFNGR1 also facilitates the activation of STAT3, albeit to a lesser extent. Furthermore, the phosphorylated IFNGR1 domain provides a docking site for SOCS1, which regulates the JAK-STAT pathway by competing with STAT1 for binding to IFNGR1. IFNGR1 can exist as a monomer and forms a heterodimer with IFNGR2 to constitute the IFNG receptor complex. The receptor also interacts with JAK1, STAT1, and SOCS1, orchestrating a complex signaling network in response to IFNG.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    IFNGR1; IFN-Gamma-R1; Prev. IFNGR; Interferon Gamma Receptor 1 Isoform 2; CD119; Immune Interferon Receptor 1; Interferon-Gamma Receptor Alpha Chain; Antiviral Protein, Type 2; Interferon Gamma Receptor Alpha-Chain; AVP, Type 2; IFN-Gamma Receptor 1; IMD2

  • AA Sequence

    EMGTADLGPSSVPIPTNVTIESYNMNTIVYWEYQNMPQDPVFTVEVKNYGVKNAEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSKEFAVCRDGKIGPPKLDIRKEEKQIIIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLVIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

  • Predicted Molecular Mass

    52.8 kDa

  • Molecular Weight

    Approximately 63 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00