IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc)
IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived IFN-gamma R1/CD119 protein, expressed by HEK293, with C-hFc tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-gamma R1/CD119 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived IFN-gamma R1/CD119 protein, expressed by HEK293, with C-hFc tag.
Background
IFN-gamma R1 (CD119) serves as the receptor subunit for interferon gamma (IFNG), playing pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Teaming up with the transmembrane accessory factor IFNGR2, IFNGR1 forms a functional receptor complex. Upon IFNG binding, the intracellular domain of IFNGR1 undergoes conformational changes, allowing the association of downstream signaling components, including JAK1 and JAK2. Activated JAK1 phosphorylates IFNGR1, creating a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription. IFNGR1 also facilitates the activation of STAT3, albeit to a lesser extent. Furthermore, the phosphorylated IFNGR1 domain provides a docking site for SOCS1, which regulates the JAK-STAT pathway by competing with STAT1 for binding to IFNGR1. IFNGR1 can exist as a monomer and forms a heterodimer with IFNGR2 to constitute the IFNG receptor complex. The receptor also interacts with JAK1, STAT1, and SOCS1, orchestrating a complex signaling network in response to IFNG.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-hFc
-
Accession
NP_001253229.1 (E18-G245)
-
Gene ID101866179
-
Protein Length
Partial
-
Synonyms
IFNGR1; IFN-Gamma-R1; Prev. IFNGR; Interferon Gamma Receptor 1 Isoform 2; CD119; Immune Interferon Receptor 1; Interferon-Gamma Receptor Alpha Chain; Antiviral Protein, Type 2; Interferon Gamma Receptor Alpha-Chain; AVP, Type 2; IFN-Gamma Receptor 1; IMD2
-
AA Sequence
EMGTADLGPSSVPIPTNVTIESYNMNTIVYWEYQNMPQDPVFTVEVKNYGVKNAEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSKEFAVCRDGKIGPPKLDIRKEEKQIIIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLVIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
-
Predicted Molecular Mass
52.8 kDa
-
Molecular Weight
Approximately 63 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)