1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-10
  5. IL-10 Protein, Pig

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Pig is the recombinant pig-derived IL-10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE IL-10 Protein, Pig

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Pig is the recombinant pig-derived IL-10 protein, expressed by E. coli , with tag free.

Background

IL-10, a major immune regulatory cytokine, plays a pivotal role in modulating the immune system by exerting profound anti-inflammatory functions, effectively limiting excessive tissue disruption caused by inflammation. Mechanistically, IL-10 binds to its heterotetrameric receptor, composed of IL10RA and IL10RB, initiating JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, driving the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, curbing their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by diminishing the expression of MHC-class II and co-stimulatory molecules, thereby hindering their capacity to induce T cell activation. Moreover, IL-10 maintains control over the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. Structurally, IL-10 forms a homodimer and engages with IL10RA and IL10RB in its regulatory functions.

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized IL-10 Protein, Pig at 2 μg/mL (100 μl/well) can bind Rhesus IL10RA-hFc and the EC50 is 25-100 ng/mL.
2.Measured in a cell proliferation assay using MC/9-2 mouse mast cells and the ED50 is typically 1-5 ng/mL.

Species

Pig

Source

E. coli

Tag

Tag Free

Accession

Q29055 (S19-N175)

Gene ID
Molecular Construction
N-term
IL-10 (S19-N175)
Accession # Q29055
C-term
Protein Length

Full Length of Mature Protein

AA Sequence

SIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN

Predicted Molecular Mass
18.2 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-10 Protein, Pig Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-10 Protein, Pig

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10 Protein, Pig
Cat. No.:
HY-P73154
Quantity:
MCE Japan Authorized Agent: