IL-10 Protein, Pig
Based on 1 publication(s) in Google Scholar
IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Pig is the recombinant pig-derived IL-10 protein, expressed by E. coli , with tag free.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Pig is the recombinant pig-derived IL-10 protein, expressed by E. coli , with tag free.
Background
IL-10, a major immune regulatory cytokine, plays a pivotal role in modulating the immune system by exerting profound anti-inflammatory functions, effectively limiting excessive tissue disruption caused by inflammation. Mechanistically, IL-10 binds to its heterotetrameric receptor, composed of IL10RA and IL10RB, initiating JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, driving the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, curbing their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by diminishing the expression of MHC-class II and co-stimulatory molecules, thereby hindering their capacity to induce T cell activation. Moreover, IL-10 maintains control over the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. Structurally, IL-10 forms a homodimer and engages with IL10RA and IL10RB in its regulatory functions.
Verified Bioactivity
1.Measured by its binding ability in a functional ELISA. Immobilized IL-10 Protein, Pig at 2 μg/mL (100 μl/well) can bind Rhesus IL10RA-hFc and the EC50 is 25-100 ng/mL.
2.Measured in a cell proliferation assay using MC/9-2 mouse mast cells and the ED50 is typically 1-5 ng/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Vet Microbiol
IL-10 upregulates SOCS3 to inhibit type I interferon signaling to promote PoRVA replication in intestinal epithelial cells. [Abstract]2024 Nov:298:110259. PMID: 39332165
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag Tag Free
-
Accession
Q29055 (S19-N175)
-
Molecular Construction
-
N-term
-
IL-10 (S19-N175)
Accession # Q29055 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A
-
AA Sequence
SIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN
-
Predicted Molecular Mass
18.2 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)