IL-22 Protein, Human (P.pastoris, His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. IL-22 Protein, Human (P.pastoris, His) is the recombinant human-derived IL-22 protein, expressed by P. pastoris , with C-His labeled tag.

IL-22 Protein assumes a pivotal role in modulating tissue responses during inflammation, demonstrating a crucial involvement in the regeneration of epithelial cells to preserve barrier function following injury and forestall further tissue damage. Unlike most cytokines, IL-22 exerts no influence on immune cells, relying on a heterodimeric receptor comprising the specific IL22RA1 receptor, found on non-immune cells in various organs, and the shared subunit IL10RB. The binding of IL-22 to IL22RA1 activates the tyrosine kinases JAK1 and TYK2, subsequently triggering STAT3 activation. This, in turn, promotes cell survival and proliferation through the STAT3, ERK1/2, and PI3K/AKT pathways, contributing to the phosphorylation of GSK3B at 'Ser-9' and CTTN. Additionally, IL-22 fosters epithelial cell spreading.

Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is typically 0.9 ng/mL.

Human

P. pastoris

C-His

Q9GZX6 (A34-I179)

50616  [NCBI]

Full Length of Mature Protein

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.