1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Human (CHO)

IL-3 Protein, Human (CHO)

Cat. No.: HY-P7040A
COA Handling Instructions

IL-3 Protein, Human (CHO) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $107 In-stock
50 μg $300 In-stock
100 μg $510 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-3 Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-3 Protein, Human (CHO) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Background

Interleukin-3 (IL-3) is aglycoprotein belonging to the hematopoietic growth factor family that in preclinical in vitro and in vivo studies has exhibited a multilineage activity. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF)[1]. Human interleukin-3 (hIL-3) is a multipotent hematopoietic cytokine produced by mitogen and antigen-activated keratinocytes, T-lymphocytes, mast cells, NK cells, monocytes and endothelial cells. The hematopoietic progenitor cells are proliferated and differentiated with the help of hIL-3 protein into mature erythrocytes, mast cells, megakaryocytes and granulocytes. The potential use of hIL-3 protein has been extensively tested in various clinical applications such as bone marrow transplantation, hematological malignancies, cytopenias, aplastic anemia and various types of cancer[2].

Biological Activity

The ED50 is <0.1 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >1 × 107 units/mg.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P08700 (A20-F152)

Gene ID
Synonyms
rHuIL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor
AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Weight

17-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-3 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Human (CHO)
Cat. No.:
HY-P7040A
Quantity:
MCE Japan Authorized Agent: