IP-10/CXCL10 Protein, Rat (HEK293)
Based on 1 Customer Validation
CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CXCL10 Protein, Rat (HEK293) consists of 77 amino acids (I22-P98) and is expressed in HEK293 cells.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Rat (HEK293) consists of 77 amino acids (I22-P98) and is expressed in HEK293 cells.
Background
CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].
Verified Bioactivity
The ED50 is <300 ng/mL as measured by CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells).
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
P48973 (I22-P98)
-
Molecular Construction
-
N-term
-
CXCL10 (I22-P98)
Accession # P48973 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1
-
AA Sequence
IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
-
Predicted Molecular Mass
8.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]
[2]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]
[3]. Huilian Bu, et al. Spinal IFN-γ-induced protein-10 (CXCL10) mediates metastatic breast cancer-induced bone pain by activation of microglia in rat models. Breast Cancer Res Treat. 2014 Jan;143(2):255-63. [Content Brief]
[4]. Tim Clarner, et al. CXCL10 triggers early microglial activation in the cuprizone model. J Immunol. 2015 Apr 1;194(7):3400-13. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)