1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. IP-10/CXCL10 Protein, Rat (HEK293)

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CXCL10 Protein, Rat (HEK293) consists of 77 amino acids (I22-P98) and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Rat (HEK293) consists of 77 amino acids (I22-P98) and is expressed in HEK293 cells.

Background

CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
  CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

Biological Activity

The ED50 is <300 ng/mL as measured by CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells).

  • Measured by its ability to chemoattract CHO-K1 cells transfected with human Gα15 and rat CXCR3. The ED50 for this effect is 62.33 ng/mL.
Species

Rat

Source

HEK293

Tag

Tag Free

Accession

P48973 (I22-P98)

Gene ID
Molecular Construction
N-term
CXCL10 (I22-P98)
Accession # P48973
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rRtIP-10/CRG-2/CXCL10; C-X-C motif chemokine 10; Gamma-IP10; Mob-1
AA Sequence

IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP

Molecular Weight

Approximately 8.7 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IP-10/CXCL10 Protein, Rat (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IP-10/CXCL10 Protein, Rat (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IP-10/CXCL10 Protein, Rat (HEK293)
Cat. No.:
HY-P7225
Quantity:
MCE Japan Authorized Agent: