JAM-C/CD323 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293, Fc) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293, Fc) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
JAM-C/CD323, a junctional adhesion protein, orchestrates heterotypic cell-cell interactions with its receptor JAM2, exerting regulatory control over diverse cellular processes. Notably, it plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. This function involves the interaction with JAM3-expressing hematopoietic cells. In the context of leukocyte extravasation, JAM-C facilitates transmigration through the endothelium, underscoring its central role in this physiological process. Furthermore, in spermatogenesis, JAM-C engages with both Sertoli and germ cells, essential for anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Additionally, JAM-C is implicated in angiogenesis, cell migration regulation, and myocyte fusion during myogenesis, promoting chemotaxis of vascular endothelial cells and stimulating angiogenesis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9BX67 (V32-N241)
-
Molecular Construction
-
N-term
-
JAM-A (V32-N241)
Accession # Q9BX67 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
JAM3; Junctional Adhesion Molecule C; Junctional Adhesion Molecule 3; JAMC; JAM-C; JAM-2; JAM-3
-
AA Sequence
VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
-
Predicted Molecular Mass
51 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.2 μm filtered solution of 50 mM Tris-Citrate, 0.3 M NaCl, pH 6.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)