JAM-C/CD323 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293, Fc) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293, Fc) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

JAM-C/CD323, a junctional adhesion protein, orchestrates heterotypic cell-cell interactions with its receptor JAM2, exerting regulatory control over diverse cellular processes. Notably, it plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. This function involves the interaction with JAM3-expressing hematopoietic cells. In the context of leukocyte extravasation, JAM-C facilitates transmigration through the endothelium, underscoring its central role in this physiological process. Furthermore, in spermatogenesis, JAM-C engages with both Sertoli and germ cells, essential for anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Additionally, JAM-C is implicated in angiogenesis, cell migration regulation, and myocyte fusion during myogenesis, promoting chemotaxis of vascular endothelial cells and stimulating angiogenesis.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • JAM-A (V32-N241)
      Accession # Q9BX67
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    JAM3; Junctional Adhesion Molecule C; Junctional Adhesion Molecule 3; JAMC; JAM-C; JAM-2; JAM-3

  • AA Sequence

    VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

  • Predicted Molecular Mass

    51 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.2 μm filtered solution of 50 mM Tris-Citrate, 0.3 M NaCl, pH 6.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00