JAM-C/CD323 Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with tag free.

Background

JAM-C/CD323, a junctional adhesion protein, orchestrates heterotypic cell-cell interactions with its receptor JAM2, exerting regulatory control over diverse cellular processes. Notably, it plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. This function involves the interaction with JAM3-expressing hematopoietic cells. In the context of leukocyte extravasation, JAM-C facilitates transmigration through the endothelium, underscoring its central role in this physiological process. Furthermore, in spermatogenesis, JAM-C engages with both Sertoli and germ cells, essential for anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Additionally, JAM-C is implicated in angiogenesis, cell migration regulation, and myocyte fusion during myogenesis, promoting chemotaxis of vascular endothelial cells and stimulating angiogenesis.

Verified Bioactivity

Measured by its ability to chemoattract HUVEC cells. The ED50 for this effect is 0.114 μg/mL, corresponding to a specific activity is 8.772×103 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract HUVEC cells. The ED50 for this effect is 0.114 μg/mL, corresponding to a specific activity is 8.772×103 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • JAM-A (V32-N241)
      Accession # Q9BX67
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    JAM3; Junctional Adhesion Molecule C; Junctional Adhesion Molecule 3; JAMC; JAM-C; JAM-2; JAM-3

  • AA Sequence

    VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00