KLHL3 Protein, Human (sf9, His, StrepⅡ)
KLHL3 serves as a substrate-specific linker in the BCR E3 ubiquitin ligase complex and is critical for ion transport in the distal nephron. The BCR(KLHL3) complex coordinates the degradation of WNK1, WNK4, WNK3, and CLDN8, fine-tunes NaCl reabsorption, and maintains electrolyte balance. KLHL3 Protein, Human (sf9, His, Strep) is the recombinant human-derived KLHL3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
KLHL3 serves as a substrate-specific linker in the BCR E3 ubiquitin ligase complex and is critical for ion transport in the distal nephron. The BCR(KLHL3) complex coordinates the degradation of WNK1, WNK4, WNK3, and CLDN8, fine-tunes NaCl reabsorption, and maintains electrolyte balance. KLHL3 Protein, Human (sf9, His, Strep) is the recombinant human-derived KLHL3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
KLHL3 functions as a substrate-specific adapter within the BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex, playing a crucial role in regulating ion transport in the distal nephron. The BCR(KLHL3) complex orchestrates the ubiquitination and subsequent degradation of WNK1, WNK4, and WNK3, which are activators of the Na-Cl cotransporter SLC12A3/NCC in distal convoluted tubule cells of the kidney. This regulatory mechanism finely tunes NaCl reabsorption, contributing to overall electrolyte balance. Additionally, the BCR(KLHL3) complex targets CLDN8, a tight-junction protein crucial for paracellular chloride transport in the kidney, for ubiquitination and degradation. Through its role in protein ubiquitination, KLHL3 emerges as a key component in the dynamic regulation of ion transport processes, highlighting its significance in maintaining renal function.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q9UH77 (E2-L587)
-
Gene ID26249
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
KLHL3 (E2-L587)
Accession # Q9UH77 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
KLHL3; Kelch (Drosophila)-Like 3; Kelch Like Family Member 3; Kelch-Like 3 (Drosophila); Kelch-Like Protein 3; KLHL3 Protein; KIAA1129; PHA2D
-
AA Sequence
EGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)