KLHL3 Protein, Human (sf9, His, StrepⅡ)

KLHL3 serves as a substrate-specific linker in the BCR E3 ubiquitin ligase complex and is critical for ion transport in the distal nephron. The BCR(KLHL3) complex coordinates the degradation of WNK1, WNK4, WNK3, and CLDN8, fine-tunes NaCl reabsorption, and maintains electrolyte balance. KLHL3 Protein, Human (sf9, His, Strep) is the recombinant human-derived KLHL3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

KLHL3 functions as a substrate-specific adapter within the BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex, playing a crucial role in regulating ion transport in the distal nephron. The BCR(KLHL3) complex orchestrates the ubiquitination and subsequent degradation of WNK1, WNK4, and WNK3, which are activators of the Na-Cl cotransporter SLC12A3/NCC in distal convoluted tubule cells of the kidney. This regulatory mechanism finely tunes NaCl reabsorption, contributing to overall electrolyte balance. Additionally, the BCR(KLHL3) complex targets CLDN8, a tight-junction protein crucial for paracellular chloride transport in the kidney, for ubiquitination and degradation. Through its role in protein ubiquitination, KLHL3 emerges as a key component in the dynamic regulation of ion transport processes, highlighting its significance in maintaining renal function.

Human

Sf9 insect cells

N-StrepⅡ;N-8*His

Q9UH77 (E2-L587)

26249

Partial

EGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.