Leptin Protein, Mouse

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

A sensor (leptin production by adipose cells) monitors the size of the adipose tissue mass. Hypothalamic centers receive and integrate the intensity of the leptin signal through leptin receptors (LRb). Effector systems, including the sympathetic nervous system, control the two main determinants of energy balance-energy intake and energy expenditure^[1]. Recessive mutations in the leptingene are associated with massive obesity in mice and humans, establishing a genetic basis for obesity. Leptin circulates in blood and acts on the brain to regulate food intake and energy expenditure. When fat mass falls, plasma leptin levels fall, stimulating appetite and suppressing energy expenditure until fat mass is restored. When fat mass increases, leptin levels increase, suppressing appetite until weight is lost. This system maintains homeostatic control of adipose tissue mass^[2].

1.Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED₅₀ for this effect is 1.286ng/mL, corresponding to a specific activity is 7.77×10⁵ units/mg.
2.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human Leptin R. The ED₅₀ for this effect is ≤0.5 ng/mL, corresponding to a specific activity is ≥2×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED₅₀ for this effect is 1.286 ng/mL, corresponding to a specific activity is 7.77×10⁵ units/mg.

Mouse

E. coli

Tag Free

Q544U0 (V22-C167)

16846  [NCBI]

Full Length of Mature Protein

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Approximately 14 kDa band in SDS-PAGE under reducing conditions

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, pH 9.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.  [Content Brief]

  [2]. Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60(1):1-9.  [Content Brief]