Copy Link Print Information

Leptin Protein, Mouse

7 Cited Publications
Customer Review

Based on 7 publication(s) in Google Scholar

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Leptin Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Leptin Protein, Mouse is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Background

A sensor (leptin production by adipose cells) monitors the size of the adipose tissue mass. Hypothalamic centers receive and integrate the intensity of the leptin signal through leptin receptors (LRb). Effector systems, including the sympathetic nervous system, control the two main determinants of energy balance-energy intake and energy expenditure[1]. Recessive mutations in the leptingene are associated with massive obesity in mice and humans, establishing a genetic basis for obesity. Leptin circulates in blood and acts on the brain to regulate food intake and energy expenditure. When fat mass falls, plasma leptin levels fall, stimulating appetite and suppressing energy expenditure until fat mass is restored. When fat mass increases, leptin levels increase, suppressing appetite until weight is lost. This system maintains homeostatic control of adipose tissue mass[2].

Verified Bioactivity

1.Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED50 for this effect is 1.286 ng/mL, corresponding to a specific activity is 7.77×105 units/mg.
2.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human Leptin R. The ED50 for this effect is ≤0.5 ng/mL, corresponding to a specific activity is ≥2×106 units/mg.

Results
  • Experimental Validation Results for Leptin Protein, Mouse
    Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED50 for this effect is 1.286 ng/mL, corresponding to a specific activity is 7.77×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q544U0 (V22-C167)

  • Gene ID
    16846  [NCBI]
  • Molecular Construction
    • N-term
    • Leptin (V22-C167)
      Accession # Q544U0
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Leptin; Obese Protein; Obesity Factor; LEP; OB; OBS

  • AA Sequence

    VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Leptin Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, pH 9.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88. [Content Brief]

[2]. Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60(1):1-9. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED50 for this effect is 1.286 ng/mL, corresponding to a specific activity is 7.77×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using MCF-7 Human breast cancer cells. The ED50 for this effect is 1.286 ng/mL, corresponding to a specific activity is 7.77×105 units/mg.

  • 1/16

    Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    Customer Validation
     The changes of average daily food intake during the Leptin Protein, Mouse (1 mg/kg; i.p.; twice daily for 3 d) sensitivity test.

  • 1/16

    Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    Customer Validation
     Leptin Protein, Mouse (1 mg/kg; i.p.; twice daily for 3 d). The immunofluorescent staining of P-STAT3 at the arcuate nucleus of hypothalamus in DIO mice and intensity of positive stain areas were quantified by Image J.

  • 1/16

    Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    Customer Validation
     Leptin Protein, Mouse (0.1 mg/kg; i.p.; once daily) administration markedly increased P-STAT3 intensity in the hypothalamus of ob/ob mice.

  • 1/16

    Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Nutr Biochem. 2024 Jan:123:109512. [Abstract]

    Customer Validation
     A 24-h food intake and energy intake of SD and HD mice after Leptin Protein, Mouse (2.5 mg/kg; i.p.) treatment compared to saline treatment.

  • 1/16

    Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Nutr Biochem. 2024 Jan:123:109512. [Abstract]

    Customer Validation
     Two sets of mice received Leptin Protein, Mouse (2.5 mg/kg; i.p.), were killed after 1 h, and the hypothalamic protein was extracted. Representative images of western blotting for pSTAT3 and STAT3 levels were shown.

  • Leptin Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Experimental Validation Results for Leptin Protein, Mouse
  • Leptin Protein, Mouse Product Image

  • Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    The changes of average daily food intake during the Leptin Protein, Mouse (1 mg/kg; i.p.; twice daily for 3 d) sensitivity test.

  • Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    Leptin Protein, Mouse (1 mg/kg; i.p.; twice daily for 3 d). The immunofluorescent staining of P-STAT3 at the arcuate nucleus of hypothalamus in DIO mice and intensity of positive stain areas were quantified by Image J.

  • Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci China Life Sci. 2025 Oct 10. [Abstract]

    Leptin Protein, Mouse (0.1 mg/kg; i.p.; once daily) administration markedly increased P-STAT3 intensity in the hypothalamus of ob/ob mice.

  • Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Nutr Biochem. 2024 Jan:123:109512. [Abstract]

    A 24-h food intake and energy intake of SD and HD mice after Leptin Protein, Mouse (2.5 mg/kg; i.p.) treatment compared to saline treatment.

  • Leptin Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Nutr Biochem. 2024 Jan:123:109512. [Abstract]

    Two sets of mice received Leptin Protein, Mouse (2.5 mg/kg; i.p.), were killed after 1 h, and the hypothalamic protein was extracted. Representative images of western blotting for pSTAT3 and STAT3 levels were shown.