Leptin Protein, Carassius auratus (P.pastoris, His)
Based on 1 Customer Validation
Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag.
- Species: Others
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag.
Background
Leptin protein assumes a pivotal role in the intricate regulation of energy balance and the control of body weight. Upon release into the circulation, leptin exerts both central and peripheral effects by binding to its receptor, LEPR, present in various tissues. This binding initiates the activation of several major signaling pathways, contributing to the multifaceted mechanisms involved in the regulation of energy homeostasis.
Technical Parameters
-
Species Others
-
Source P. pastoris
-
Tag N-8*His
-
Accession
B8YI02 (P22-C171)
-
Gene ID/
-
Molecular Construction
-
N-term
-
8*His
-
Leptin (P22-C171)
Accession # B8YI02 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LEP; Leptin (Murine Obesity Homolog); Prev. OBS; Obese Protein; Prev. OB; Obese, Mouse, Homolog Of; Obesity Factor; LEPD; Leptin; Leptin (Obesity Homolog, Mouse)
-
AA Sequence
PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC
-
Predicted Molecular Mass
18.3 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 8% trehalose, 4% mannitol, 0.02% Tween 80 (w/v), pH 5.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
