1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Leptin
  5. Leptin Protein, Carassius auratus (P.pastoris, His)

Leptin Protein, Carassius auratus (P.pastoris, His)

Cat. No.: HY-P70181
Handling Instructions Technical Support

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag.

Background

Leptin protein assumes a pivotal role in the intricate regulation of energy balance and the control of body weight. Upon release into the circulation, leptin exerts both central and peripheral effects by binding to its receptor, LEPR, present in various tissues. This binding initiates the activation of several major signaling pathways, contributing to the multifaceted mechanisms involved in the regulation of energy homeostasis.

Species

Others

Source

P. pastoris

Tag

N-8*His

Accession

B8YI02 (P22-C171)

Gene ID

/

Molecular Construction
N-term
8*His
Leptin (P22-C171)
Accession # B8YI02
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rCaLeptin, His; Leptin; Obese Protein; Obesity Factor; LEP; OB; OBS
AA Sequence

PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC

분자량

Approximately 17.0 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 8% trehalose, 4% mannitol, 0.02% Tween 80 (w/v), pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Leptin Protein, Carassius auratus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Leptin Protein, Carassius auratus (P.pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Leptin Protein, Carassius auratus (P.pastoris, His)
Cat. No.:
HY-P70181
수량:
MCE Japan Authorized Agent: