1. Recombinant Proteins
  2. Others
  3. MICA Protein, Human (HEK293, His-Avi)

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. MICA is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations of MICA have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma[1][2].

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q96QC4 (E24-Q308)

Gene ID
Molecular Construction
N-term
MICA (E24-Q308)
Accession # Q96QC4
8*His-Avi
C-term
Protein Length

Partial

Synonyms
FLJ60820; MGC111087; MICA; PERB11.1; DAMA-345G11.2; FLJ36918; FLJ60820; MGC21250
AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Predicted Molecular Mass
35.8 kDa
Molecular Weight

Approximately 55-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

MICA Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MICA Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MICA Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P77997
Quantity:
MCE Japan Authorized Agent: