MICA Protein, Human (HEK293, His-Avi)

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface and is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells, MICA has been associated with susceptibility to psoriasis 1 and psoriatic arthritis. MICA Protein, Human (HEK293, His-Avi) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

MHC class I chain-related protein A (MICA) is a highly polymorphic major histocompatability complex class I chain-related protein A. MICA is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. MICA is a ligand for the NKG2-D type II integral membrane protein receptor and functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations of MICA have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma[1][2].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MICA (E24-Q308)
      Accession # Q96QC4
    • 8*His-Avi
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MICA; MHC Class I Related Chain A Isoform B1; MHC Class I Polypeptide-Related Sequence A; MHC Class I Related Chain A Isoform B2; PERB11.1; MHC Class I Related Chain A Isoform C; Major Histocompatibility Complex Class I Chain-Related Protein A; MHC Class

  • AA Sequence

    EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

  • Predicted Molecular Mass

    35.8 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00