Copy Link Print Information

MICA Protein, Human (HEK293, mFc)

Customer Review

Based on 1 Customer Validation

MICA is the gene for major histocompatibility complex class I chain-associated protein A, encoding a highly polymorphic cell surface protein. Unlike traditional class I molecules, it lacks beta-2-microglobulin association. MICA Protein, Human (HEK293, mFc) is the recombinant human-derived MICA protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • MICA Protein, Human (HEK293, mFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MICA is the gene for major histocompatibility complex class I chain-associated protein A, encoding a highly polymorphic cell surface protein. Unlike traditional class I molecules, it lacks beta-2-microglobulin association. MICA Protein, Human (HEK293, mFc) is the recombinant human-derived MICA protein, expressed by HEK293 , with N-mFc labeled tag.

Background

MICA, the gene encoding the major histocompatibility complex class I chain-related protein A, produces a highly polymorphic protein expressed on the cell surface. Unlike conventional class I molecules, it does not appear to associate with beta-2-microglobulin. Functioning as a ligand for the NKG2-D type II integral membrane protein receptor, this protein acts as a stress-induced antigen recognized by intestinal epithelial gamma delta T cells. Genetic variations in MICA have been linked to susceptibility to psoriasis 1 and psoriatic arthritis. The shedding of MICA-related antibodies and ligands is implicated in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene yields multiple transcript variants. MICA demonstrates ubiquitous expression, with notable levels observed in the lung (RPKM 8.7), endometrium (RPKM 7.4), and 25 other tissues.

Verified Bioactivity

Immobilized Human MICA alpha 3, mFc Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Anti-MICA Antibody, hFc Tag with the EC50 of ≤0.13 μg/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-mFc
  • Accession

    NP_001276081.1 (R105-S200)

  • Gene ID
    100507436  [NCBI]
  • Molecular Construction
    • N-term
    • mFc
    • MICA (R105-S200)
      Accession # NP_001276081.1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    MICA; MHC Class I Related Chain A Isoform B1; MHC Class I Polypeptide-Related Sequence A; MHC Class I Related Chain A Isoform B2; PERB11.1; MHC Class I Related Chain A Isoform C; Major Histocompatibility Complex Class I Chain-Related Protein A; MHC Class

  • AA Sequence

    RRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • MICA Protein, Human (HEK293, mFc) Product Image
    1/16
  • MICA Protein, Human (HEK293, mFc) Product Image