1. Recombinant Proteins
  2. Others
  3. MICA Protein, Human (HEK293, mFc)

MICA is the gene for major histocompatibility complex class I chain-associated protein A, encoding a highly polymorphic cell surface protein. Unlike traditional class I molecules, it lacks beta-2-microglobulin association. MICA Protein, Human (HEK293, mFc) is the recombinant human-derived MICA protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MICA is the gene for major histocompatibility complex class I chain-associated protein A, encoding a highly polymorphic cell surface protein. Unlike traditional class I molecules, it lacks beta-2-microglobulin association. MICA Protein, Human (HEK293, mFc) is the recombinant human-derived MICA protein, expressed by HEK293 , with N-mFc labeled tag.

Background

MICA, the gene encoding the major histocompatibility complex class I chain-related protein A, produces a highly polymorphic protein expressed on the cell surface. Unlike conventional class I molecules, it does not appear to associate with beta-2-microglobulin. Functioning as a ligand for the NKG2-D type II integral membrane protein receptor, this protein acts as a stress-induced antigen recognized by intestinal epithelial gamma delta T cells. Genetic variations in MICA have been linked to susceptibility to psoriasis 1 and psoriatic arthritis. The shedding of MICA-related antibodies and ligands is implicated in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene yields multiple transcript variants. MICA demonstrates ubiquitous expression, with notable levels observed in the lung (RPKM 8.7), endometrium (RPKM 7.4), and 25 other tissues.

Biological Activity

Immobilized Human MICA alpha 3, mFc Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Anti-MICA Antibody, hFc Tag with the EC50 of ≤0.13 μg/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

NP_001276081.1 (R105-S200)

Gene ID
Molecular Construction
N-term
mFc
MICA (R105-S200)
Accession # NP_001276081.1
C-term
Protein Length

Partial

Synonyms
MICA; MIC-A; MICA alpha 3
AA Sequence

RRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS

Predicted Molecular Mass
36.8 kDa
Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MICA Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MICA Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MICA Protein, Human (HEK293, mFc)
Cat. No.:
HY-P700790
Quantity:
MCE Japan Authorized Agent: