MIP-5/CCL15 Protein, Human (68a.a, His)

MIP-5/CCL15 Protein, Human (68a.a, His) is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human (68a.a, His) binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human (68a.a, His) is a recombinant human MIP-5/CCL15 (S46–I113) expressed by E. coli with a his tag at the C end.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MIP-5/CCL15 Protein, Human (68a.a, His) is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human (68a.a, His) binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human (68a.a, His) is a recombinant human MIP-5/CCL15 (S46–I113) expressed by E. coli with a his tag at the C end[1].

Background

CCL15, also known as macrophage inhibitory protein 5 (MIP-5), leukocyte chemokine 1 (Lkn-1) and human CC chemokine 2 (HCC-2), is a small cytokine belonging to the CC chemokine family, a cluster of chemokines located on human chromosome 17 with a gene sequence similar to CC motif chemokine ligand 5 (CCL5) and CC motif chemokine ligand 3 ( CCL3). CCL15 can be expressed in certain leukocytes and macrophages in the liver, small intestine, colon, and lung[1]. CCL15 acts as a chemoattractant for neutrophils, monocytes and lymphocytes and can bind to chemokine receptors CCR1 and CCR3, of which CCR3 is the major receptor for human eosinophils and plays an important role in the migration of monocytes, lymphocytes and neutrophils. Meanwhile, CCL15 plays an effector molecule role in the regulation of hematopoietic cells and host defense. Recombinant human CCL15 is also the most abundant chemokine in follicular thyroid cancer (FTC). CCL15 has been reported to be elevated in bronchoalveolar lavage fluid (BALF) from patients with stage III nodular disease and in peripheral blood from patients with severe persistent asthma, contributing to the severity and persistence of the disease by targeting its receptors (especially CCR1) in an autocrine manner[2][3].

In Vitro

CCL15 (0.1-1000 ng/mL) can mediate human eosinophilic leukemia EoL-1 cells migration and increase PKCσ activity in a time-dependent manner via the Ptx-sensitive Gi/Go protein and PLC. Besides, it enhances butyric acid-induced EoL-1 cell differentiation[2].
CCL15 is the most abundant chemokine in follicular thyroid carcinoma(FTC). 51.4-fold more CCL15 mRNA is present in FTC than in follicular adenoma. Condition medium of FTC cell lines induced THP-1 cell chemotaxis by 33 ~ 77%, and anti-CCL15 neutralizing antibodies reduces THP-1 cell migration in a dose-dependent manner[3].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL15 (S46-I113)
      Accession # Q16663
    • His
    • C-term
  • Protein Length

    Full Length of CCL15(25-92) Chain

  • Synonyms

    CCL15; Chemokine (C-C Motif) Ligand 15; Prev. SCYA15; C-C Motif Chemokine 15; HCC-2; Leukotactin 1; NCC-3; NCC3; MIP-5; New CC Chemokine 3; Macrophage Inflammatory Protein 5; CC Chemokine 3; Chemokine CC-2; Leukotactin-1; MIP-1 Delta; MRP-2B; HMRP-2B; Mrp

  • AA Sequence

    SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

  • Predicted Molecular Mass

    8.9 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00