MKK6 Protein, Human (sf9, His-GST)
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (sf9, His-GST) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (sf9, His-GST) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
MKK6, a dual specificity protein kinase, serves as an integral component of the MAP kinase signal transduction pathway. In collaboration with MAP3K3/MKK3, MKK6 catalyzes the simultaneous phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13, and MAPK14, playing a pivotal role in regulating cellular responses to cytokines and various stress stimuli. Both MKK3 and MKK6 are essential for activating MAPK11 and MAPK13 in response to environmental stress, with MKK6 emerging as the principal activator of MAPK11 upon TNF stimulation. Additionally, MKK6 phosphorylates and activates PAK6. The downstream effects of the p38 MAP kinase signal transduction pathway include the direct activation of transcription factors such as ATF2 and ELK1. Within this pathway, MKK6 mediates the phosphorylation of STAT4 through MAPK14 activation, leading to the activation of STAT4 and its regulation of gene expression in response to IL-12 stimulation. Furthermore, the pathway is crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction, as well as IFNG-dependent gene transcription. MKK6 plays a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, contributes to endochondral ossification, and likely influences SOX9 as a downstream target of the p38 MAPK pathway. Moreover, MKK6 is involved in mediating apoptotic cell death in thymocytes and serves as a regulator for melanocyte dendricity by modulating Rho family GTPases.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P52564-1 (M1-D334)
-
Molecular Construction
-
N-term
-
His-GST
-
MKK6 (M1-D334)
Accession # P52564-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAP2K6; Stress-Activated Protein Kinase Kinase 3; Prev. PRKMK6; SAPK Kinase 3; SAPKK3; SAPKK-3; MEK6; MAPKK 6; MKK6; CRCMSL; MAPKK6; MEK 6; Protein Kinase, Mitogen-Activated, Kinase 6 (MAP Kinase Kinase 6); Mitogen-Activated Protein Kinase Kinase; Dual Sp
-
AA Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
-
Predicted Molecular Mass
65.3 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)