MMP-8 Protein, Mouse (HEK293, His)

MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-8 protein, expressed by HEK293 , with C-His labeled tag.

MMP-8 protein has the capacity to degrade various types of fibrillar collagens, including type I, II, and III. It is suggested that MMP-8 may be involved in the breakdown of collagen fibers during the process of uterine involution.

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 441 pmoles/min/μg.

Mouse

HEK293

C-8*His

O70138 (F21-S465)

17394  [NCBI]

Full Length of Mature Protein (with Propeptide)

FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS

Approximately 65-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20mM MES, 150mM NaCl (pH 5.5).

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.