MMP-8 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-8 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-8 protein, expressed by HEK293 , with C-His labeled tag.
Background
MMP-8 protein has the capacity to degrade various types of fibrillar collagens, including type I, II, and III. It is suggested that MMP-8 may be involved in the breakdown of collagen fibers during the process of uterine involution.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 441 pmoles/min/μg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
O70138 (F21-S465)
-
Molecular Construction
-
N-term
-
MMP-8 (F21-S465)
Accession # O70138 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
MMP8; PMNL Collagenase; Prev. CLG1; MMP-8; Matrix Metalloproteinase 8 (Neutrophil Collagenase); PMN Leukocyte Collagenase; Matrix Metalloproteinase-8; Collagenase 2; Neutrophil Collagenase; HNC; Matrix Metallopeptidase 8; PMNL-CL
-
AA Sequence
FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
-
Predicted Molecular Mass
51.9 kDa
-
Molecular Weight
Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20mM MES, 150mM NaCl (pH 5.5).
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
