MMP-8 Protein, Mouse (HEK293)
Based on 1 Customer Validation
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (HEK293) is the recombinant mouse-derived MMP-8 protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (HEK293) is the recombinant mouse-derived MMP-8 protein, expressed by HEK293 , with tag free.
Background
MMP-8 protein has the capacity to degrade various types of fibrillar collagens, including type I, II, and III. It is suggested that MMP-8 may be involved in the breakdown of collagen fibers during the process of uterine involution.
Verified Bioactivity
Measured by its ability to cleave 80µM fluorogenic peptide substrate MCA-Lys-Pro-Leu-Gly-Leu-DAP(DNP)-Ala-Arg-NH2 (HY-P4931) at room temperature in kinetic mode for 5 minutes. The specific activity is 3846.05 pmol/min/µg. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
O70138 (F21-S465)
-
Molecular Construction
-
N-term
-
MMP-8 (F21-S465)
Accession # O70138 -
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
MMP8; PMNL Collagenase; Prev. CLG1; MMP-8; Matrix Metalloproteinase 8 (Neutrophil Collagenase); PMN Leukocyte Collagenase; Matrix Metalloproteinase-8; Collagenase 2; Neutrophil Collagenase; HNC; Matrix Metallopeptidase 8; PMNL-CL
-
AA Sequence
FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
-
Molecular Weight
65-75 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)