PF-4/CXCL4 Protein, Mouse
Based on 1 Customer Validation
Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.
Platelet factor 4 (PF4) is a protein released during platelet aggregation, exerting its influence on various physiological processes. It plays a crucial role in neutralizing the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Beyond its anticoagulant properties, PF4 demonstrates chemotactic effects on neutrophils and monocytes, contributing to immune responses. Additionally, PF4 acts to inhibit endothelial cell proliferation, suggesting a role in the regulation of vascular processes. Structurally, PF4 forms a homotetramer, and it interacts with TNFAIP6, specifically engaging with its Link domain. This intricate interplay highlights the multifaceted functions of PF4 in hemostasis, immune response, and vascular regulation.
1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100 ng/mL.
2.Measured by its ability to inhibit the FGF basic-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 0.1-1 μg/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Z126 (V30-S105)
-
Molecular Construction
-
N-term
-
Platelet factor 4 (V30-S105)
Accession # Q9Z126 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PF4; C-X-C Motif Chemokine 4; Platelet Factor 4; Oncostatin-A; SCYB4; Iroplact; CXCL4; PF-4; Chemokine (C-X-C Motif) Ligand 4
-
AA Sequence
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
-
Predicted Molecular Mass
8.2 kDa
-
Molecular Weight
Approximately 8-12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
