Copy Link Print Information

PRKCB2 Protein, Human (Active, sf9, His-GST)

PRKCB2 is a calcium-activated, phospholipid, and diacylglycerol (DAG)-dependent serine/threonine protein kinase involved in various cellular processes, including regulation of the B cell receptor (BCR) signaling body, oxidative stress-induced apoptosis, androgen receptor-dependent transcriptional regulation, insulin signaling, and endothelial cell proliferation. PRKCB2, Human (Active, sf9, His-GST) is a recombinant human PRKCB2 protein expressed by sf9 cells and tagged with N-His and N-GST.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • PRKCB2 Protein, Human (Active, sf9, His-GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PRKCB2 is a calcium-activated, phospholipid, and diacylglycerol (DAG)-dependent serine/threonine protein kinase involved in various cellular processes, including regulation of the B cell receptor (BCR) signaling body, oxidative stress-induced apoptosis, androgen receptor-dependent transcriptional regulation, insulin signaling, and endothelial cell proliferation. PRKCB2, Human (Active, sf9, His-GST) is a recombinant human PRKCB2 protein expressed by sf9 cells and tagged with N-His and N-GST.

Background

PRKCB2 is a calcium-activated, phospholipid and diacylglycerol (DAG)-dependent serine/threonine protein kinase involved in various cellular processes, such as regulation of the B cell receptor (BCR) signaling complex, oxidative stress-induced apoptosis, androgen receptor-dependent transcriptional regulation, insulin signaling, and endothelial cell proliferation. It plays a crucial role in B cell activation by regulating BCR-induced NF-κB activation. PRKCB2 mediates activation of the canonical NF-κB pathway (NFKB1) by directly phosphorylating Ser-559, Ser-644, and Ser-652 sites of CARD11/CARMA1. Phosphorylation induces CARD11/CARMA1 to bind to lipid rafts and recruits the BCL10-MALT1 complex and MAP3K7/TAK1, thereby activating the IKK complex, leading to NFKB1 nuclear translocation and activation. Furthermore, PRKCB2 also plays a direct role in the negative feedback regulation of BCR signaling by directly phosphorylating BTK at the Ser-180 site. BTK phosphorylation alters BTK plasma membrane localization, thereby inhibiting BTK activity.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-8*His;N-GST
  • Accession

    P05771-2 (A2-S673)

  • Gene ID
    5579
  • Molecular Construction
    • N-term
    • His-GST
    • PRKCB2 (A2-S673)
      Accession # P05771-2
    • C-term
  • Protein Length

    Full Length of Isoform 2

  • Synonyms

    PRKCB; PKC-B; Prev. PRKCB1; Protein Kinase C, Beta 1; Prev. PKCB; Protein Kinase C, Beta; Prev. PRKCB2; PKCI(2); Protein Kinase C Beta Type; PKCbeta; PKC-Beta; PKCβ; Protein Kinase C Beta; Protein Kinase C, Beta 1 Polypeptide

  • AA Sequence

    ADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS

  • Predicted Molecular Mass

    104.6 kDa

  • Molecular Weight

    Approximately 105 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PRKCB2 Protein, Human (Active, sf9, His-GST) Product Image
    1/16
  • PRKCB2 Protein, Human (Active, sf9, His-GST) Product Image