PXR Protein, Human
The PXR protein is a nuclear receptor that acts as a multifunctional transcription factor activated by a variety of endogenous and exogenous compounds. It regulates genes involved in the metabolism and secretion of substances, responding to ligands such as rifampicin, hypericin, gugulin, colupulone, isoflavones, pregnenolone and progesterone. PXR Protein, Human is the recombinant human-derived PXR protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PXR protein is a nuclear receptor that acts as a multifunctional transcription factor activated by a variety of endogenous and exogenous compounds. It regulates genes involved in the metabolism and secretion of substances, responding to ligands such as rifampicin, hypericin, gugulin, colupulone, isoflavones, pregnenolone and progesterone. PXR Protein, Human is the recombinant human-derived PXR protein, expressed by E. coli , with tag free.
PXR Protein, a nuclear receptor, serves as a versatile transcription factor activated by a range of endogenous and xenobiotic compounds. It plays a pivotal role in regulating the transcription of multiple genes involved in the metabolism and secretion of potentially harmful substances, including xenobiotics, drugs, and endogenous compounds. Activated by various ligands such as the antibiotic rifampicin, as well as plant metabolites like hyperforin, guggulipid, colupulone, and isoflavones, the response to specific ligands is species-specific. PXR is also activated by naturally occurring steroids, including pregnenolone and progesterone. It binds to response elements in the promoters of key genes such as CYP3A4 and ABCB1/MDR1. Operating in association with RXR, PXR forms heterodimers and interacts with coactivator NCOA1. Moreover, PXR engages in ligand-dependent interactions with the clock proteins CRY1 and CRY2 through its NR LBD domain, adding another layer of complexity to its regulatory functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O75469 (S130-S434)
-
Gene ID8856
-
Molecular Construction
-
N-term
-
PXR (S130-S434)
Accession # O75469 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NR1I2; Steroid And Xenobiotic Receptor; Nuclear Receptor Subfamily 1 Group I Member 2; Orphan Nuclear Receptor PAR1; Orphan Nuclear Receptor PXR; Nuclear Receptor Subfamily 1, Group I, Member 2; Pregnane X Receptor; PARq; PAR2; PAR1; SXR; SAR; PXR; PRR; O
-
AA Sequence
SERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
