ROS1 Protein, Human (Active, sf9, His)

ROS1 Protein, Human (sf9, His) is the recombinant human-derived ROS1, expressed by Sf9 insect cells , with His labeled tag. ,

ROS1 is a receptor tyrosine kinase (RTK) involved in epithelial cell differentiation and regionalization of the proximal epididymal epithelium. NELL2 serves as an endogenous ligand for ROS1. Upon stimulation by NELL2, ROS1 activates intracellular signaling pathways, triggering epididymal epithelial differentiation and subsequent sperm maturation (By similarity). It may activate several downstream signaling pathways related to cell differentiation, proliferation, growth, and survival, including the PI3 kinase-mTOR pathway. ROS1 mediates the phosphorylation of PTPN11, an activator of this pathway. Additionally, it may phosphorylate and activate the transcription factor STAT3 to regulate anchorage-independent cell growth. ROS1 also mediates the phosphorylation and activation of VAV3, a guanine nucleotide exchange factor involved in cell morphology regulation. Other downstream signaling proteins potentially activated by ROS1 include AKT1, MAPK1, MAPK3, IRS1, and PLCG2.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 3.125 nM, the conversion rate is about 23%.

Human

Sf9 insect cells

His

P08922 (I1934-E2232)

6098

Partial

IENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKSRDE

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.4, 150 mM NaCl, 5% glycerol, 2 mM TCEP.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.