ROS1 Protein, Human (Active, sf9, His)
Based on 1 Customer Validation
ROS1 Protein, Human (sf9, His) is the recombinant human-derived ROS1, expressed by Sf9 insect cells , with His labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ROS1 Protein, Human (sf9, His) is the recombinant human-derived ROS1, expressed by Sf9 insect cells , with His labeled tag. ,
Background
ROS1 is a receptor tyrosine kinase (RTK) involved in epithelial cell differentiation and regionalization of the proximal epididymal epithelium. NELL2 serves as an endogenous ligand for ROS1. Upon stimulation by NELL2, ROS1 activates intracellular signaling pathways, triggering epididymal epithelial differentiation and subsequent sperm maturation (By similarity). It may activate several downstream signaling pathways related to cell differentiation, proliferation, growth, and survival, including the PI3 kinase-mTOR pathway. ROS1 mediates the phosphorylation of PTPN11, an activator of this pathway. Additionally, it may phosphorylate and activate the transcription factor STAT3 to regulate anchorage-independent cell growth. ROS1 also mediates the phosphorylation and activation of VAV3, a guanine nucleotide exchange factor involved in cell morphology regulation. Other downstream signaling proteins potentially activated by ROS1 include AKT1, MAPK1, MAPK3, IRS1, and PLCG2.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 3.125 nM, the conversion rate is about 23%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His
-
Accession
P08922 (I1934-E2232)
-
Gene ID6098
-
Protein Length
Partial
-
Synonyms
ROS1; Proto-Oncogene C-Ros-1; ROS Proto-Oncogene 1, Receptor Tyrosine Kinase; V-Ros UR2 Sarcoma Virus Oncogene Homolog 1 (Avian); MCF3; ROS Proto-Oncogene 1 , Receptor Tyrosine Kinase; ROS; Transmembrane Tyrosine-Specific Protein Kinase; C-Ros-1; Receptor
-
AA Sequence
IENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKSRDE
-
Predicted Molecular Mass
36.3 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.4, 150 mM NaCl, 5% glycerol, 2 mM TCEP.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
