1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. RSK
  5. RSK3/RPS6KA1
  6. RSK1 Protein, Human (sf9, His)

RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9, His) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9, His) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

RSK1, a serine/threonine-protein kinase, functions downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and plays a crucial role in mediating mitogenic and stress-induced cellular responses. RSK1 orchestrates the activation of transcription factors such as CREB1, ETV1/ER81, and NR4A1/NUR77, contributing to cellular proliferation, survival, and differentiation. Through its intricate involvement in the mTOR signaling pathway, RSK1 regulates translation by phosphorylating RPS6 and EIF4B, facilitating the assembly of pre-initiation complexes and enhancing cap-dependent translation. Furthermore, RSK1 exerts its influence on various cellular processes, including inhibiting the pro-apoptotic functions of BAD and DAPK1, promoting cell survival, and regulating cell cycle progression by phosphorylating CDKN1B. In response to insulin, RSK1 indirectly modulates gene transcription by phosphorylating GSK3B, and in the mTOR nutrient-sensing pathway, it phosphorylates TSC2 and RPTOR, influencing mTORC1 activity. Additionally, RSK1 participates in the feedback regulation of mTORC1 and mTORC2 by phosphorylating DEPTOR. Notably, during microbial infections, RSK1 is implicated in promoting the late transcription and translation of viral lytic genes in Kaposi's sarcoma-associated herpesvirus/HHV-8 infection when constitutively activated.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

Q15418 (Q33-T353)

Gene ID

6195

Molecular Construction
N-term
8*His
RSK1 (Q33-T353)
Accession # Q15418
C-term
Protein Length

Partial

Synonyms
RPS6KA1; Ribosomal protein S6 kinase alpha-1; S6K-alpha-1; 90 kDa ribosomal protein S6 kinase 1; p90-RSK 1; p90RSK1; p90S6K; MAP kinase-activated protein kinase 1a; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAPK-1a; Ribosomal S6 kinase 1; RSK-1
AA Sequence

QPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDT

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

RSK1 Protein, Human (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
RSK1 Protein, Human (sf9, His)
Cat. No.:
HY-P701772
Cantidad:
MCE Japan Authorized Agent: