Serpin A3N Protein, Mouse (P.pastoris, His)

The serpin A3N protein is ubiquitously found in a variety of tissues, showing elevated expression in the brain, heart, liver, lung, spleen, testis, and thymus, implying a variety of physiological functions. In contrast, it shows lower expression in bone marrow, kidney, and skeletal muscle, suggesting a tissue-specific pattern of regulation. Serpin A3N Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serpin A3N protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Serpin A3N Protein, Mouse (P.pastoris, His) is 398 a.a., with molecular weight of ~46.8 kDa.

Serpin A3N protein, a ubiquitous player in various tissues, is expressed at elevated levels in the brain, heart, liver, lung, spleen, testis, and thymus. Its presence in these tissues underscores its potential involvement in diverse physiological functions within these organs. In contrast, Serpin A3N is expressed at lower levels in the bone marrow, kidney, and skeletal muscle, suggesting a differential regulatory pattern across tissues. The varying expression levels highlight the tissue-specific roles and regulatory mechanisms of Serpin A3N, emphasizing its importance in maintaining homeostasis and contributing to the functionality of specific organs and systems.

Mouse

P. pastoris

N-6*His

Q91WP6 (21F-418K)

20716  [NCBI]

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Approximately 46.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.