Copy Link Print Information

TFF1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for TFF1 Protein, Human (HEK293, His)
  • Experimental Validation Results for TFF1 Protein, Human (HEK293, His)
  • TFF1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Trefoil Factor 1 (TFF1) protein acts as a stabilizer for the mucous gel that overlays the gastrointestinal mucosa, playing a crucial role in providing a robust physical barrier against a variety of noxious agents. By contributing to the integrity of the mucous layer, TFF1 aids in the protection and defense of the gastrointestinal tract from potential harmful substances. Its stabilizing function underscores its importance in maintaining the mucosal barrier, which is essential for the overall health and protection of the gastrointestinal mucosa.

Verified Bioactivity

Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-10 μg/mL of Recombinant Human TFF1 can effectively induce ERK1/2 phosphorylation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-10 μg/mL of Recombinant Human TFF1 can effectively induce ERK1/2 phosphorylation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P04155 (E25-F84)

  • Gene ID
    7031  [NCBI]
  • Molecular Construction
    • N-term
    • TFF1 (E25-F84)
      Accession # P04155
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TFF1; HPS2; Prev. BCEI; Polypeptide P1.A; PNR-2; Protein PS2; HP1.A; Breast Cancer, Estrogen-Inducible Sequence Expressed In; PS2; Breast Cancer Estrogen-Inducible Sequence; D21S21; Gastrointestinal Trefoil Protein PS2; Trefoil Factor 1; Breast Cancer Est

  • AA Sequence

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

  • Predicted Molecular Mass

    7.5 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 5-10 μg/mL of Recombinant Human TFF1 can effectively induce ERK1/2 phosphorylation.

  • TFF1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TFF1 Protein, Human (HEK293, His)
  • Experimental Validation Results for TFF1 Protein, Human (HEK293, His)
  • TFF1 Protein, Human (HEK293, His) Product Image