TFF1 Protein, Human
Based on 1 Customer Validation
TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free.
Background
Trefoil Factor 1 (TFF1) protein acts as a stabilizer for the mucous gel that overlays the gastrointestinal mucosa, playing a crucial role in providing a robust physical barrier against a variety of noxious agents. By contributing to the integrity of the mucous layer, TFF1 aids in the protection and defense of the gastrointestinal tract from potential harmful substances. Its stabilizing function underscores its importance in maintaining the mucosal barrier, which is essential for the overall health and protection of the gastrointestinal mucosa.
Verified Bioactivity
Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 10μg/mL of Recombinant Human TFF1 can effectively induce ERK1/2 phosphorylation.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P04155 (E25-F84)
-
Molecular Construction
-
N-term
-
TFF1 (E25-F84)
Accession # P04155 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFF1; HPS2; Prev. BCEI; Polypeptide P1.A; PNR-2; Protein PS2; HP1.A; Breast Cancer, Estrogen-Inducible Sequence Expressed In; PS2; Breast Cancer Estrogen-Inducible Sequence; D21S21; Gastrointestinal Trefoil Protein PS2; Trefoil Factor 1; Breast Cancer Est
-
AA Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
-
Predicted Molecular Mass
6.7 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)