Tenascin/Tnc Protein, Human (His)
Based on 2 publication(s) in Google Scholar
TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.
The TNC protein, an extracellular matrix protein, plays a crucial role in guiding migrating neurons and axons during development, contributing to processes such as synaptic plasticity and neuronal regeneration. It facilitates neurite outgrowth from cortical neurons grown on a monolayer of astrocytes, indicative of its involvement in the intricate cellular interactions within the nervous system. Acting as a ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3, and alpha-V/beta-6, TNC establishes molecular connections essential for cellular communication and signaling. In the context of tumors, TNC stimulates angiogenesis by promoting the elongation, migration, and sprouting of endothelial cells. Structurally, TNC exists as a homohexamer, with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. This versatile protein also interacts with CSPG4, indicating its involvement in diverse cellular and molecular processes across different biological contexts.
Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. rhTenascin-C immobilized at 15 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 54.61% NIH3/T3 cell adhesion (5x104 cells/well, 100 μL/well)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
iScience
Hyperlipidemia exacerbates frozen shoulder fibrosis by activating the TGF-β/Smad2/3 signaling pathway via the TBX5-TNC-Itgα2 axis. [Abstract]2026 Jan 9;29(2):114660. PMID: 41660234 -
FASEB J
Melatonin Accelerates Diabetic Wound Repair via Modulation of Tenascin C and Interleukin-10 in Fibroblasts. [Abstract]2026 Jun 15;40(11):e72010. PMID: 42233548
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P24821-1 (D1888-A2201)
-
Molecular Construction
-
N-term
-
6*His
-
TNC (D1888-A2201)
Accession # P24821-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TNC; Neuronectin; Prev. HXB; Cytotactin; Prev. DFNA56; Tenascin-C; TN; MGC167029; Tenascin; GMEM; Glioma-Associated-Extracellular Matrix Antigen; TN-C; Deafness, Autosomal Dominant 56; JI; Tenascin-C Additional Domain 1; Hexabrachion (Tenascin C, Cytotact
-
AA Sequence
DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
-
Predicted Molecular Mass
39.5 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
