Tenascin/Tnc Protein, Human (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.

Background

The TNC protein, an extracellular matrix protein, plays a crucial role in guiding migrating neurons and axons during development, contributing to processes such as synaptic plasticity and neuronal regeneration. It facilitates neurite outgrowth from cortical neurons grown on a monolayer of astrocytes, indicative of its involvement in the intricate cellular interactions within the nervous system. Acting as a ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3, and alpha-V/beta-6, TNC establishes molecular connections essential for cellular communication and signaling. In the context of tumors, TNC stimulates angiogenesis by promoting the elongation, migration, and sprouting of endothelial cells. Structurally, TNC exists as a homohexamer, with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. This versatile protein also interacts with CSPG4, indicating its involvement in diverse cellular and molecular processes across different biological contexts.

Verified Bioactivity

Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. rhTenascin-C immobilized at 15 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 54.61% NIH3/T3 cell adhesion (5x104 cells/well, 100 μL/well)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • TNC (D1888-A2201)
      Accession # P24821-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNC; Neuronectin; Prev. HXB; Cytotactin; Prev. DFNA56; Tenascin-C; TN; MGC167029; Tenascin; GMEM; Glioma-Associated-Extracellular Matrix Antigen; TN-C; Deafness, Autosomal Dominant 56; JI; Tenascin-C Additional Domain 1; Hexabrachion (Tenascin C, Cytotact

  • AA Sequence

    DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

  • Predicted Molecular Mass

    39.5 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00