1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)

TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)

Cat. No.: HY-P70637
Handling Instructions Technical Support

TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

Background

Thrombopoietin (TPO) is a growth factor for the megakaryocytic/platelet lineage. TPO is expressed in the neurons of the human central nervous system and is neuroprotective. TPO is the key enzyme in the biosynthesis of thyroid hormones T3 and T4[1][2].

Biological Activity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 11.69 ng/mL, corresponding to a specific activity is 8.55×104 units/mg.

  • Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 11.69 ng/mL, corresponding to a specific activity is 8.55×104 units/mg.
Species

Human

Source

HEK293

Tag

N-6*His;C-6*His

Accession

P40225-1 (S22-G353)

Gene ID
Molecular Construction
N-term
6*His
TPO (S22-G353)
Accession # P40225-1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO
AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Predicted Molecular Mass
37.3 kDa
분자량

Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

TPO/Thrombopoietin Protein, Human (HEK293, C/N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)
Cat. No.:
HY-P70637
수량:
MCE Japan Authorized Agent: