TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)
Based on 1 Customer Validation
TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.
Background
Thrombopoietin (TPO) is a growth factor for the megakaryocytic/platelet lineage. TPO is expressed in the neurons of the human central nervous system and is neuroprotective. TPO is the key enzyme in the biosynthesis of thyroid hormones T3 and T4[1][2].
Verified Bioactivity
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 11.69 ng/mL, corresponding to a specific activity is 8.55×104 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His;C-6*His
-
Accession
P40225-1 (S22-G353)
-
Molecular Construction
-
N-term
-
6*His
-
TPO (S22-G353)
Accession # P40225-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
THPO; Prepro-Thrombopoietin; Prev. MGDF; MPL Ligand; Myeloproliferative Leukemia Virus Oncogene Ligand; ML; Megakaryocyte Growth And Development Factor; Thrombopoietin Nirs Variant 3; Megakaryocyte Colony-Stimulating Factor; Thrombopoietin Nirs Variant 2;
-
AA Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
-
Predicted Molecular Mass
37.3 kDa
-
Molecular Weight
Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Li L, et al. c-Mpl and TPO expression in the human central nervous system neurons inhibits neuronal apoptosis. Aging (Albany NY). 2020;12(8):7397-7410. [Content Brief]
[2]. El Shabrawy RM, et al. Serum Anti-TPO and TPO Gene Polymorphism as a Predictive Factor for Hidden Autoimmune Thyroiditis in Patient with Bronchial Asthma and Allergic Rhinitis. Egypt J Immunol. 2016;23(1):77-86. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
