1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. multi-CSF/IL-3
  5. IL-3 Protein, Human (His)

IL-3 Protein, Human (His)

Cat. No.: HY-P70576
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-3 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.05-0.3 ng/mL..
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P08700 (A20-F152)

Gene ID
Synonyms
Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Weight

13-16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IL-3 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Human (His)
Cat. No.:
HY-P70576
Quantity:
MCE Japan Authorized Agent: