Copy Link Print Information

IL-3 Protein, Human (His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-3 Protein, Human (His)
  • Experimental Validation Results for IL-3 Protein, Human (His)
  • IL-3 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Additionally, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival. Moreover, it participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal transducing subunit IL3RB. Stimulation of this receptor leads to the rapid activation of JAK2 kinase activity, initiating a STAT5-mediated transcriptional program. Alternatively, IL-3 contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK. The cytokine also interacts with IL3RA to modulate its diverse physiological effects.

Verified Bioactivity

1.The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.05-0.3 ng/mL.
2.Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89 μM as determined in BLI assay.
3.Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 μM as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P08700 (A20-F152)

  • Gene ID
    3562  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-3 (A20-F152)
      Accession # P08700
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I

  • AA Sequence

    APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

  • Predicted Molecular Mass

    16.6 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 5% sucrose, 0.05% Tween 80, pH 6.5.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.09441 ng/mL, corresponding to a specific activity is 1.059×10^7 U/mg.

  • IL-3 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for IL-3 Protein, Human (His)
  • Experimental Validation Results for IL-3 Protein, Human (His)
  • IL-3 Protein, Human (His) Product Image