TREM-2 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TREM-2 Protein forms a receptor signaling complex with TYROBP, mediating signaling and cell activation upon ligand binding. It acts as a receptor for amyloid-beta protein 42, facilitating its uptake and degradation by microglia, resulting in microglial activation, proliferation, migration, apoptosis, and cytokine expression. Additionally, TREM-2 serves as a receptor for lipoprotein particles and apolipoproteins, enhancing their uptake in microglia. It binds phospholipids and regulates microglial proliferation, phagocytosis of apoptotic neurons, and response to oxidative stress. Furthermore, TREM-2 suppresses PI3K and NF-kappa-B signaling, promotes anti-apoptotic NF-kappa-B signaling during oxidative stress, and plays a role in microglial MTOR activation and metabolism. It is involved in age-related changes in microglial numbers and triggers immune responses in macrophages and dendritic cells. TREM-2 also mediates cytokine-induced multinucleated giant cell formation and is implicated in osteoclast differentiation. The protein interacts with TYROBP, and this interaction is crucial for stabilizing the TREM-2 C-terminal fragment.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TREM-2 (H19-S174)
      Accession # XP_005553122.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TREM2; Trem2b; Triggering Receptor Expressed On Myeloid Cells 2; Trem2c; TREM-2; Triggering Receptor Expressed On Myeloid Cells 2a; Triggering Receptor Expressed On Monocytes 2; PLOSL2; Trem2a; AD17

  • AA Sequence

    HNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEIPFPPTS

  • Predicted Molecular Mass

    18.3 kDa

  • Molecular Weight

    Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00