40 Results for "

α2δ

" in MedChemExpress (MCE) Product Catalog:
Products (40)

40 Results for "α2δ" in MCE Product Catalog:

9
9 Publications Verification
Cat. No.: HY-N0215
CAS No.: 63-91-2
Synonyms: (S)-2-Amino-3-phenylpropionic acid
L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca + channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
6
6 Cited Publications
Cat. No.: HY-12650
CAS No.: 1138245-13-2
Purity:  99.31%
Synonyms: DS5565
Target:  

Calcium Channel

Research Areas:  

Neurological Disease

Mirogabalin (DS-5565) is a novel, preferentially selective α2δ-1 ligand characterized by high potency and selectivity to the α2δ-1 subunit of voltage-sensitive calcium channel complexes in the CNS.
loading...
    loading...
6
6 Cited Publications
Cat. No.: HY-108006
CAS No.: 1138245-21-2
Purity:  99.57%
Synonyms: DS 5565 besylate
Target:  

Calcium Channel

Research Areas:  

Neurological Disease

Mirogabalin besylate is a selective and orally available ligand for the α2δ subunit of voltage-gated calcium channels, with Kds of 13.5 nM, 22.7 nM, 27 nM, and 47.6 nM for human α2δ-1, human α2δ-2, rat α2δ-1, and rat α2δ-2, respectively.
loading...
    loading...
2
2 Cited Publications
Cat. No.: HY-N0215S10
CAS No.: 439685-11-7
Synonyms: (S)-2-Amino-3-phenylpropionic acid-13C9
L-Phenylalanine- 13C9 is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
1
1 Cited Publications
Cat. No.: HY-N0215S12
CAS No.: 56253-90-8
Synonyms: (S)-2-Amino-3-phenylpropionic acid-d5
L-Phenylalanine-d5 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
1
1 Cited Publications
Cat. No.: HY-N0215S1
CAS No.: 17942-32-4
Synonyms: (S)-2-Amino-3-phenylpropionic acid-d8
L-Phenylalanine-d8 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
1
1 Cited Publications
Cat. No.: HY-N0215S8
CAS No.: 180268-82-0
Synonyms: (S)-2-Amino-3-phenylpropionic acid-13C6
L-Phenylalanine- 13C6 is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
1
1 Cited Publications
Cat. No.: HY-N0215S7
CAS No.: 136056-02-5
Synonyms: (S)-2-Amino-3-phenylpropionic acid-3-13C
L-Phenylalanine-3- 13C is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
1
1 Cited Publications
Cat. No.: HY-N0215S2
CAS No.: 81201-86-7
Synonyms: (S)-2-Amino-3-phenylpropionic acid-13C
L-Phenylalanine- 13C is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-142240
CAS No.: 2209104-84-5
Synonyms: HSK16149
Target:  

Calcium Channel

Research Areas:  

Neurological Disease

Crisugabalin is an orally active, selective ligand for the α2δ subunit of voltage-gated calcium channels, with a target IC50 of 3.96 nM in rats. Crisugabalin inhibits the binding of [ 3H]gabapentin to the α2δ subunit, reduces calcium influx, decreases neuronal excitability, and impairs nociceptive transmission. Crisugabalin alleviates mechanical allodynia, neuropathic pain and inflammatory pain in rats, and reduces phase II pain behaviors. Crisugabalin can be used in research related to chronic pain, neuropathic pain, diabetic neuropathy, fibromyalgia, inflammatory pain, diabetic peripheral neuropathy and postherpetic neuralgia.
loading...
    loading...
Cat. No.: HY-N0215R
CAS No.: 63-91-2
Synonyms: (S)-2-Amino-3-phenylpropionic acid (Standard)
L-Phenylalanine (Standard) is the analytical standard of L-Phenylalanine. This product is intended for research and analytical applications. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-N0215S5
CAS No.: 29700-34-3
Synonyms: (S)-2-Amino-3-phenylpropionic acid-15N
L-Phenylalanine- 15N is the 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-N0215S11
CAS No.: 878339-23-2
Synonyms: (S)-2-Amino-3-phenylpropionic acid-13C9,15N
L-Phenylalanine- 13C9, 15N is the 13C- and 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-N0215S3
CAS No.: 221346-31-2
Synonyms: (S)-2-Amino-3-phenylpropionic acid-d2
L-Phenylalanine-d2 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-12650S1
Synonyms: DS5565-d4
Mirogabalin-d4 (DS5565-d4) is a deuterated compound of Mirogabalin (HY-12650), a ligand that selectively targets the voltage-sensitive calcium channel complex α2δ-1 [2].
loading...
    loading...
Cat. No.: HY-U00388
CAS No.: 313653-15-5
Target:  

Calcium Channel

Research Areas:  

Neurological Disease

α2δ ligand 1 is a ligand to the α2δ-1 subunit of voltage-sensitive calcium channel, extracted from patent US20040186177.
loading...
    loading...
Cat. No.: HY-148866
CAS No.: 2143584-82-9
Target:  

Calcium Channel

Research Areas:  

Neurological Disease Endocrinology

Cavα2δ1&NET-IN-3 (example 216) is an inhibitor of the subunit α2δ of voltage-gated calcium channels (VGCC) and noradrenaline transporter (NET). Cavα2δ1&NET-IN-3 has Kis of 100-500 nM for human α2δ-1 subunit of Cav2.2 calcium channel and NET, respectively .
loading...
    loading...
Cat. No.: HY-N0215S14
Synonyms: (S)-2-Amino-3-phenylpropionic acid-15N,d8
L-Phenylalanine- 15N,d8 is the deuterium and 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca2+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
loading...
    loading...
Cat. No.: HY-P3431
CAS No.: 2279952-25-7
Target:  

iGluR

Research Areas:  

Neurological Disease

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
loading...
    loading...
Cat. No.: HY-148863
CAS No.: 2143586-17-6
Cavα2δ1&NET-IN-2 (Compound 45CS) is a dual inhibitor of the α2δ‑1 subunit of voltage-gated calcium channels (Cavα2δ-1) and the norepinephrine transporter (NET). Cavα2δ1&NET-IN-2 inhibits Cavα2δ-1 with a Ki of 454 nM. Cavα2δ1&NET-IN-2 inhibits NET with a Ki of 59 nM and IC50 of 7 nM. Cavα2δ1&NET-IN-2 can be used for research of pain .
loading...
    loading...