Teriparatide
Based on 12 publication(s) in Google Scholar
Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research.
For research use only. We do not sell to patients.
- Purity: 99.98%
- CAS No.: 52232-67-4
- Formula: C181H291N55O51S2
- Molecular Weight:4117.72
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Teriparatide
More- Bone Res. 2026 Mar 17;14(1):31. [Abstract]
- Nat Commun. 2023 May 31;14(1):3159. [Abstract]
- Mater Today Bio. 2025 Sep 4:35:102272. [Abstract]
- J Orthop Translat. 2025 Jun 9:53:99-111. [Abstract]
- J Orthop Translat. 2022 Dec 7:38:241-255. [Abstract]
- Mater Des. 2025 Nov 15
- Biomedicines. 2025 Feb 3;13(2):342. [Abstract]
- J Cell Physiol. 2024 Aug;239(8):e31297. [Abstract]
- Tissue Cell. 2026 Jul 16;104(Pt 1):103791.
- Res Sq. 2025 Sep 24.
- bioRxiv. 2024 Jul 26:2024.07.26.605282. [Abstract]
- Biomed Pharmacother. 2019 Apr:112:108578. [Abstract]
Biological Activity
Description
IC50 & Target
IC50: 2 nM (PTH)[1].
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Female New Zealand white rabbits[1]
-
Dosage:20 μg/kg
-
Administration:Subcutaneous injection; daily, for 4 weeks
-
Result:Increased the pore ratio, number, and density as well as the cortical area, thickness, and bone mineral content (BMC), without significant influencing the volumetric bone mineral density (BMD).
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 52232-67-4
-
Appearance Solid
-
Molecular Weight 4117.72
-
Formula C181H291N55O51S2
-
Color White to off-white
-
Synonyms
Human parathyroid hormone-(1-34); hPTH (1-34)
-
Sequence
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
-
Sequence Shortening
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (12)
-
Journal Impact Factor
-
Most Recent
-
Bone Res
C/EBPβ dictates postmenopausal FSHβ transcription and blockade of AEP/C/EBPβ pathway alleviates osteoporosis. [Abstract]2026 Mar 17;14(1):31. PMID: 41844581 -
Nat Commun
An injectable liposome-anchored teriparatide incorporated gallic acid-grafted gelatin hydrogel for osteoarthritis treatment. [Abstract]2023 May 31;14(1):3159. PMID: 37258510 -
Mater Today Bio
An injectable phosphocreatine-grafted hydrogel incorporating hierarchically structured teriparatide/SrZnP-functionalized Zn-Cu particles for osteogenesis-angiogenesis coupling and osteoporotic bone regeneration. [Abstract]2025 Sep 4:35:102272. PMID: 40994624 -
J Orthop Translat
2025 Jun 9:53:99-111. PMID: 40538640 -
J Orthop Translat
Teriparatide ameliorates articular cartilage degradation and aberrant subchondral bone remodeling in DMM mice. [Abstract]2022 Dec 7:38:241-255. PMID: 36514714 -
-
Biomedicines
Effects of Teriparatide and Alendronate on Functional Recovery from Spinal Cord Injury and Postinjury Bone Loss. [Abstract]2025 Feb 3;13(2):342. PMID: 40002755 -
J Cell Physiol
Gprc5a is a novel parathyroid hormone-inducible gene and negatively regulates osteoblast proliferation and differentiation. [Abstract]2024 Aug;239(8):e31297. PMID: 38769895 -
-
-
bioRxiv
2024 Jul 26:2024.07.26.605282. PMID: 39091869 -
Biomed Pharmacother
The fast degradation of β-TCP ceramics facilitates healing of bone defects by the combination of BMP-2 and Teriparatide. [Abstract]2019 Apr:112:108578. PMID: 30784943
Solvent & Solubility
In Vitro:
H2O : 100 mg/mL (24.29 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 50 mg/mL (12.14 mM); Clear solution; Need ultrasonic
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (419 KB)
- English - EN (419 KB)
- Français - FR (419 KB)
- Deutsch - DE (419 KB)
- Norwegian - NO (419 KB)
- Español - ES (419 KB)
- Swedish - SV (419 KB)
- Italian - IT (419 KB)
- Korean - KR (419 KB)
- Portuguese - PT (419 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2429 mL | 1.2143 mL | 2.4285 mL | 6.0713 mL |
| 5 mM | 0.0486 mL | 0.2429 mL | 0.4857 mL | 1.2143 mL | |
| 10 mM | 0.0243 mL | 0.1214 mL | 0.2429 mL | 0.6071 mL | |
| 15 mM | 0.0162 mL | 0.0810 mL | 0.1619 mL | 0.4048 mL | |
| 20 mM | 0.0121 mL | 0.0607 mL | 0.1214 mL | 0.3036 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.