country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11291A

Copy Link Print Information

NNC0165-1273 TFA

NNC0165-1273 (TFA) is the trifluoroacetic acid of NNC0165-1273 (HY-P11291). NNC0165-1273 is an analog of gut hormone peptide YY (PYY_3-36). NNC0165-1273 has a superior affinity for Y2 receptor over Y1, Y4, and Y5 receptor. NNC0165-1273 has a potent anorectic effect and significantly reduces nighttime and ghrelin-induced food intake by producing early satiety. NNC0165-1273 inhibits ghrelin-induced cFos expression in NPY/AgRP neurons. NNC0165-1273 can be used for antiobesity therapies research.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₈₆H₂₈₀N₅₄O₅₄·xC₂HF₃O₂
Masse moléculaire:4136.54 (free base)

Stockage:

Sealed storage, away from moisture.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

NNC0165-1273 TFA Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Voir tous les produits spécifiques à Isoform Neuropeptide Y Receptor :

Chemical Information

Appearance Solid
Masse moléculaire 4136.54 (free base)
Formule C₁₈₆H₂₈₀N₅₄O₅₄·xC₂HF₃O₂
Sequence

Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Trp-Val-Thr-Arg-Gln-{β-homoArg}-Tyr-NH2
Sequence Shortening

IKPEAPGEDASPEELNRYYASLRHYLNWVTRQ-{β-homoArg}-Y-NH2
Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (282 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Jones ES, et al. Modified Peptide YY Molecule Attenuates the Activity of NPY/AgRP Neurons and Reduces Food Intake in Male Mice. Endocrinology. 2019 Nov 1;160(11):2737-2747. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtenir un devis En stock

Amount: USD 0.00

Activité biologique
- Description
Chemical Information
Pureté et documentation
Références

Nom du produit:
Cat. No.:
Quantité:
MCE Japan Authorized Agent:

Nom du produit:
CAS No.:
Species:
Pureté:
Quantité:

NNC0165-1273 TFA

Voir tous les produits spécifiques à Isoform Neuropeptide Y Receptor

Activité biologique

Chemical Information

Pureté et documentation

Références

Calculators

Help & FAQs

NNC0165-1273 TFA Related Classifications

HY-P11291A Related Classifications