Exendin-4 acetate
Based on 70 publication(s) in Google Scholar
Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.87%
- CAS. Nr.: 914454-01-6
- Formel: C186H286N50O62S
- Molecular Weight:4246.62
-
Speicherung:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Exendin-4 acetate
More- Nature. 2025 May;641(8061):192-201. [Abstract]
- Cell Metab. 2026 Jan 6;38(1):50-64.e12. [Abstract]
- Cell Metab. 2025 Dec 2;37(12):2362-2380.e8. [Abstract]
- Gut. 2023 Feb;72(2):314-324. [Abstract]
- Bioact Mater. 2025 Nov 25:57:646-659. [Abstract]
- J Adv Res. 2025 Mar 10:S2090-1232(25)00174-2. [Abstract]
- Acta Pharm Sin B. 2026 Jun 1.
- Biomaterials. 2021 Aug:275:120944. [Abstract]
- Asian J Pharm Sci. 2024 Apr;19(2):100904. [Abstract]
- Int J Biol Sci. 2022 Jan 16;18(4):1328-1346. [Abstract]
- J Neuroinflammation. 2019 Nov 28;16(1):242. [Abstract]
- Int J Nanomedicine. 2025 Mar 17:20:3363-3378. [Abstract]
- Neural Regen Res. 2023 Aug;18(8):1818-1826. [Abstract]
- Mol Med. 2024 May 8;30(1):58. [Abstract]
- Drug Deliv. 2022 Dec;29(1):548-560. [Abstract]
- Br J Pharmacol. 2025 Jan;182(1):52-68. [Abstract]
- Br J Pharmacol. 2024 Oct;181(19):3556-3575. [Abstract]
- Br J Pharmacol. 2020 Aug;177(15):3389-3402. [Abstract]
- J Invest Dermatol. 2022 May;142(5):1349-1359.e8. [Abstract]
- Biochem Pharmacol. 2025 Oct 30;243(Pt 1):117483. [Abstract]
- Biochem Pharmacol. 2025 Sep 4;242(Pt 2):117306. [Abstract]
- Mol Metab. 2026 Jun 18:110:102403. [Abstract]
- Mol Metab. 2023 Dec:78:101811. [Abstract]
- J Mater Chem B. 2026 Apr 29;14(16):5051-5065. [Abstract]
- Inflamm Res. 2024 Jul;73(7):1185-1201. [Abstract]
- Biomacromolecules. 2024 Aug 12;25(8):4946-4955. [Abstract]
- Eur J Pharmacol. 2024 Dec 5:984:177029. [Abstract]
- Eur J Pharmacol. 2024 Dec 15:985:177106. [Abstract]
- Int Immunopharmacol. 2024 Oct 25:140:112844. [Abstract]
- Int Immunopharmacol. 2023 Jul:120:110339. [Abstract]
- Int Immunopharmacol. 2021 Jan:90:107192. [Abstract]
- Am J Physiol Cell Physiol. 2024 Jul 1;327(1):C74-C96. [Abstract]
- Front Pharmacol. 2021 Jul 19;12:694476. [Abstract]
- BMC Biol. 2021 Mar 3;19(1):40. [Abstract]
- Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
- Chem Biol Interact. 2019 May 1:304:186-193. [Abstract]
- Sci Rep. 2024 Jun 14;14(1):13726. [Abstract]
- Sci Rep. 2017 Jun 28;7(1):4351. [Abstract]
- Structure. 2022 Apr 7;30(4):510-521.e3. [Abstract]
- Biomedicines. 2020 Nov 9;8(11):485. [Abstract]
- Acta Biochim Biophys Sin (Shanghai). 2017 Jul 1;49(7):573-580. [Abstract]
- Biochim Biophys Acta Mol Cell Res. 2022 May 27;1869(9):119300. [Abstract]
- Am J Physiol Endocrinol Metab. 2025 Mar 24. [Abstract]
- Am J Physiol Endocrinol Metab. 2020 Dec 1;319(6):E1019-E1030. [Abstract]
- J Biol Chem. 2018 Nov 23;293(47):18086-18098. [Abstract]
- Mater Technol (N Y N Y). 2025 Jun 17.
- J Cell Physiol. 2021 May;236(5):3641-3659. [Abstract]
- ACS Med Chem Lett. 2026 May 4;17(5):963-972. [Abstract]
- J Funct Foods. 2023 Aug, 107, 105706.
- Exp Cell Res. 2023 Feb 15;423(2):113469. [Abstract]
- J Diabetes Res. 2019 Dec 9:2019:8905917. [Abstract]
- Front Behav Neurosci. 2022 Jan 5:15:769664. [Abstract]
- Neuroscience. 2026 Apr 16:600:112-129. [Abstract]
- Gerontology. 2023;69(5):603-614. [Abstract]
- Insects. 2024 Jul 5;15(7):503. [Abstract]
- Neurogastroenterol Motil. 2019 Feb;31(2):e13482. [Abstract]
- PLoS One. 2026 Mar 12;21(3):e0343995. [Abstract]
- J Mol Histol. 2025 Jun 28;56(4):210. [Abstract]
- Diabetol Int. 2025 Jun 5;16(3):568-579. [Abstract]
- bioRxiv. 2025 Nov 18:2025.05.09.653092. [Abstract]
- Seoul National University. 2025 Jan.
- medRxiv. 2024 Jul 23.
- Res Sq. 2024 Aug 11.
- bioRxiv. 2024 August 10.
- bioRxiv. 2024 May 8.
- bioRxiv. 2024 May 3:2024.05.01.591950. [Abstract]
- bioRxiv. 2024 Mar 20:2024.03.18.585583. [Abstract]
- Annals of the Romanian Society for Cell Biology. 2021 Mar 15.
- bioRxiv. 2020 Jul.
- SSRN. 2019 Jun 27.
-
PK/PD Analysis
-
In Vivo Imaging
-
RT-PCR
-
Cell Proliferation/Viability Assay
-
RT-PCR
Biologische Aktivität
IC50: 3.22 nM (glucagon-like peptide-1 receptor)[1]
In human umbilical vein endothelial cells, Exendin-4 significantly increases NO production, endothelial NO synthase (eNOS) phosphorylation, and GTP cyclohydrolase 1 (GTPCH1) level in a dose-dependent manner[2]. Exendin-4 shows cytotoxic effects to MCF-7 breast cancer cells with IC50 of 5 μM at 48 hour[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 914454-01-6
-
Appearance Solid
-
Molecular Weight 4246.62
-
Formel C186H286N50O62S
-
Color White to off-white
-
Synonyms
Exenatide acetate
-
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
-
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (70)
-
Journal Impact Factor
-
Most Recent
-
Nature
2025 May;641(8061):192-201. PMID: 40044869 -
Cell Metab
Gut enteroendocrine cell activation using a combination of GPR119 and GPR40 agonists results in synergistic hormone secretion in mice and humans. [Abstract]2026 Jan 6;38(1):50-64.e12. PMID: 41338185 -
Cell Metab
2025 Dec 2;37(12):2362-2380.e8. PMID: 41265449 -
Gut
6α-hydroxylated bile acids mediate TGR5 signalling to improve glucose metabolism upon dietary fiber supplementation in mice. [Abstract]2023 Feb;72(2):314-324. PMID: 35697422
Exendin-4 acetate purchased from MedChemExpress. Usage Cited in: Gut. 2023 Feb;72(2):314-324. [Abstract]
Exendin-4 (2 nmol/kg/day) supplementation improves the metabolic defect of TGR5 KO fed western-style diet (WSD) enriched with oligofructose (OFS).
-
Bioact Mater
Food-derived β-lactoglobulin nanofibrils: An efficacy, safe, and scalable solution to overcome oral insulin delivery challenges. [Abstract]2025 Nov 25:57:646-659. PMID: 41377894
Exendin-4 acetate purchased from MedChemExpress. Usage Cited in: Bioact Mater. 2025 Nov 25:57:646-659. [Abstract]
Pharmacokinetics of Exendin-4 following oral versus subcutaneous administration in mice. (a) Experimental design: Fasted mice received either (i) oral PBS + exendin-4 capsule (1 mg/kg), (ii) oral nanofibrils (20 mg/mL, 200 µL) + exendin-4 capsule (1 mg/kg), or (iii) subcutaneous exendin-4 (0.1 mg/kg, pharmacological control). (b) Serum exendin-4 levels over 6 hours. (c) Corresponding AUC analysis (0-6 h).
-
J Adv Res
Discovery and identification of semaphorin 4D as a bioindicator of high fracture incidence in type 2 diabetic mice with glucose control. [Abstract]2025 Mar 10:S2090-1232(25)00174-2. PMID: 40073972
Exendin-4 acetate purchased from MedChemExpress. Usage Cited in: J Adv Res. 2025 Mar 10:S2090-1232(25)00174-2. [Abstract]
Micro-CT images representing trabecular formation in control mice, mice with T2DM, mice with T2DM treated with Exendin-4 (20 mg/kg)/Metformin, and GLP-1R knockout mice with T2DM treated with Exendin-4 within a region of interest (ROI). n=6 mice per group. Con: control; T2DM: type 2 diabetes mellitus; Met: metformin; Ex-4: Exendin-4; Micro-CT: micro-computed tomography.
-
-
Biomaterials
Effective oral delivery of Exenatide-Zn2+ complex through distal ileum-targeted double layers nanocarriers modified with deoxycholic acid and glycocholic acid in diabetes therapy. [Abstract]2021 Aug:275:120944. PMID: 34153783 -
Asian J Pharm Sci
Functionalized lipid nanoparticles modulate the blood-brain barrier and eliminate α-synuclein to repair dopamine neurons. [Abstract]2024 Apr;19(2):100904. PMID: 38601010 -
Int J Biol Sci
Activation of glucagon-like peptide-1 receptor in microglia attenuates neuroinflammation-induced glial scarring via rescuing Arf and Rho GAP adapter protein 3 expressions after nerve injury. [Abstract]2022 Jan 16;18(4):1328-1346. PMID: 35280691 -
J Neuroinflammation
The glucagon-like peptide-1 receptor agonist reduces inflammation and blood-brain barrier breakdown in an astrocyte-dependent manner in experimental stroke. [Abstract]2019 Nov 28;16(1):242. PMID: 31779652 -
Int J Nanomedicine
Aptamer Functionalized Liposomes Co-Loaded with Exenatide-4 and Coenzyme Q10 Ameliorate Type 2 Diabetes Mellitus by Improving Pancreatic β Cell Function. [Abstract]2025 Mar 17:20:3363-3378. PMID: 40125440 -
Neural Regen Res
Exendin-4 and linagliptin attenuate neuroinflammation in a mouse model of Parkinson's disease. [Abstract]2023 Aug;18(8):1818-1826. PMID: 36751811 -
Mol Med
Glucagon-like peptide-1 receptor agonist exendin 4 ameliorates diabetes-associated vascular calcification by regulating mitophagy through the AMPK signaling pathway. [Abstract]2024 May 8;30(1):58. PMID: 38720283 -
Drug Deliv
Construction and performance of exendin-4-loaded chitosan-PLGA microspheres for enhancing implant osseointegration in type 2 diabetic rats. [Abstract]2022 Dec;29(1):548-560. PMID: 35156499 -
Br J Pharmacol
The flavonoid resokaempferol improves insulin secretion from healthy and dysfunctional pancreatic β-cells. [Abstract]2025 Jan;182(1):52-68. PMID: 39327688 -
Br J Pharmacol
Role of LRP5/6/GSK-3β/β-catenin in the differences in exenatide- and insulin-promoted T2D osteogenesis and osteomodulation. [Abstract]2024 Oct;181(19):3556-3575. PMID: 38804080 -
Br J Pharmacol
Exendin-4, a GLP-1 receptor agonist regulates retinal capillary tone and restores microvascular patency after ischaemia-reperfusion injury. [Abstract]2020 Aug;177(15):3389-3402. PMID: 32232832 -
J Invest Dermatol
Adipocyte-Derived CTRP3 Exhibits Anti-Inflammatory Effects via LAMP1-STAT3 Axis in Psoriasis. [Abstract]2022 May;142(5):1349-1359.e8. PMID: 34687744 -
Biochem Pharmacol
Single-cell RNA sequencing reveals beneficial mechanisms of Exendin-4 in autoimmune uveitis. [Abstract]2025 Oct 30;243(Pt 1):117483. PMID: 41173056 -
Biochem Pharmacol
Exendin-4 Prevents oxLDL-Induced upregulation of TREM2 and attenuates foam cell formation and inflammation in Macrophages. [Abstract]2025 Sep 4;242(Pt 2):117306. PMID: 40914218 -
Mol Metab
2026 Jun 18:110:102403. PMID: 42314903 -
Mol Metab
Deletion of Ascl1 in pancreatic β-cells improves insulin secretion, promotes parasympathetic innervation, and attenuates dedifferentiation during metabolic stress. [Abstract]2023 Dec:78:101811. PMID: 37769990 -
J Mater Chem B
2026 Apr 29;14(16):5051-5065. PMID: 41978477 -
Inflamm Res
Exendin-4 blockade of T1R2/T1R3 activation improves Pseudomonas aeruginosa-related pneumonia in an animal model of chemically induced diabetes. [Abstract]2024 Jul;73(7):1185-1201. PMID: 38748233 -
Biomacromolecules
Poly(l-threonine- co-l-threonine Succinate) Thermogels for Sustained Release of Lixisenatide. [Abstract]2024 Aug 12;25(8):4946-4955. PMID: 38949062 -
Eur J Pharmacol
Exendin-4 promotes ischemia-reperfusion flap survival by upregulating Gpx4 to inhibit ferroptosis. [Abstract]2024 Dec 5:984:177029. PMID: 39366501 -
Eur J Pharmacol
Exendin-4, a glucagon-like peptide-1 receptor agonist, regulates ductus arteriosus by vasodilation and anti-remodeling through the PKA pathway. [Abstract]2024 Dec 15:985:177106. PMID: 39515563 -
Int Immunopharmacol
Exendin-4 intervention attenuates atherosclerosis severity by modulating myeloid-derived suppressor cells and inflammatory cytokines in ApoE-/- mice. [Abstract]2024 Oct 25:140:112844. PMID: 39094363 -
Int Immunopharmacol
Exenatide improves hypogonadism and attenuates inflammation in diabetic mice by modulating gut microbiota. [Abstract]2023 Jul:120:110339. PMID: 37210914 -
Int Immunopharmacol
Exenatide inhibits necrosis by enhancing angiogenesis and ameliorating ischemia/reperfusion injury in a random skin flap rat model. [Abstract]2021 Jan:90:107192. PMID: 33214096 -
Am J Physiol Cell Physiol
Reduced Incretin Receptor Trafficking upon Activation Enhances Glycemic Control and Reverses Obesity in Diet-Induced Obese Mice. [Abstract]2024 Jul 1;327(1):C74-C96. PMID: 38738303 -
Front Pharmacol
Glucagon-Like Peptide-1 Analog Exendin-4 Ameliorates Cocaine-Mediated Behavior by Inhibiting Toll-Like Receptor 4 Signaling in Mice. [Abstract]2021 Jul 19;12:694476. PMID: 34349653 -
BMC Biol
2021 Mar 3;19(1):40. PMID: 33658023 -
Front Pharmacol
GLP-1 Receptor Activation Abrogates β-Cell Dysfunction by PKA Cα-Mediated Degradation of Thioredoxin Interacting Protein. [Abstract]2019 Oct 25:10:1230. PMID: 31708773
Exendin-4 acetate purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
Exendin-4 or FSK treatment reduces ER stress-induced β-cell viability. INS-1 cells are incubated with THAP (0.5 μM), with Eexendin-4.
Exendin-4 acetate purchased from MedChemExpress. Usage Cited in: Front Pharmacol. 2019 Oct 25:10:1230. [Abstract]
INS-1 cells are incubated with THAP (0.5 μM), H89, with Exendin-4 or FSK at indicated concentration for 24 h, then the IL-1β level is analyzed by qRT-PCR (n = 3).
-
Chem Biol Interact
Exenatide alleviates adriamycin-induced heart dysfunction in mice: Modulation of oxidative stress, apoptosis and inflammation. [Abstract]2019 May 1:304:186-193. PMID: 30885636 -
Sci Rep
Liraglutide exhibits potential anti-tumor effects on the progression of intrahepatic cholangiocarcinoma, in vitro and in vivo. [Abstract]2024 Jun 14;14(1):13726. PMID: 38877189 -
Sci Rep
The dual DPP4 inhibitor and GPR119 agonist HBK001 regulates glycemic control and beta cell function ex and in vivo. [Abstract]2017 Jun 28;7(1):4351. PMID: 28659588 -
Structure
2022 Apr 7;30(4):510-521.e3. PMID: 35148829 -
Biomedicines
Exosome-Mediated Differentiation of Mouse Embryonic Fibroblasts and Exocrine Cells into β-Like Cells and the Identification of Key miRNAs for Differentiation. [Abstract]2020 Nov 9;8(11):485. PMID: 33182285 -
Acta Biochim Biophys Sin (Shanghai)
Lithium and an EPAC-specific inhibitor ESI-09 synergistically suppress pancreatic cancer cell proliferation and survival. [Abstract]2017 Jul 1;49(7):573-580. PMID: 28475672 -
Biochim Biophys Acta Mol Cell Res
GLP-1 regulates exercise endurance and skeletal muscle remodeling via GLP-1R/AMPK pathway. [Abstract]2022 May 27;1869(9):119300. PMID: 35636559 -
Am J Physiol Endocrinol Metab
GLP-1 receptor agonist exendin-4 suppresses food intake by inhibiting hindbrain orexigenic NPY neurons. [Abstract]2025 Mar 24. PMID: 40126941 -
Am J Physiol Endocrinol Metab
Glucagon-like peptide-1 alleviates diabetic kidney disease through activation of autophagy by regulating AMP-activated protein kinase-mammalian target of rapamycin pathway. [Abstract]2020 Dec 1;319(6):E1019-E1030. PMID: 32985256 -
J Biol Chem
Complement 1q-like-3 protein inhibits insulin secretion from pancreatic β-cells via the cell adhesion G protein-coupled receptor BAI3. [Abstract]2018 Nov 23;293(47):18086-18098. PMID: 30228187 -
-
J Cell Physiol
Exenatide improves random-pattern skin flap survival via TFE3 mediated autophagy augment. [Abstract]2021 May;236(5):3641-3659. PMID: 33044023 -
ACS Med Chem Lett
In Vitro Characterization of Agonist and Antagonist Peptide Binding Interaction Kinetics to GLP-1R in HEK293T Cells Using Surface Plasmon Resonance Microscopy. [Abstract]2026 May 4;17(5):963-972. PMID: 42157826 -
-
Exp Cell Res
Exendin-4 alleviates myocardial ischemia reperfusion injury by enhancing autophagy through promoting nuclear translocation of TFEB. [Abstract]2023 Feb 15;423(2):113469. PMID: 36627100 -
J Diabetes Res
Exendin-4 Protects against Hyperglycemia-Induced Cardiomyocyte Pyroptosis via the AMPK-TXNIP Pathway. [Abstract]2019 Dec 9:2019:8905917. PMID: 31886288 -
Front Behav Neurosci
Effects of Glucagon-Like Peptide-1 Receptor Agonist Exendin-4 on the Reinstatement of Cocaine-Mediated Conditioned Place Preference in Mice. [Abstract]2022 Jan 5:15:769664. PMID: 35069139 -
Neuroscience
Exenatide attenuates neuroinflammation and rescues sepsis-induced depressive behavior and cognitive dysfunction in a mouse model. [Abstract]2026 Apr 16:600:112-129. PMID: 41747818 -
Gerontology
Activation of the Vascular Smooth Muscle GLP-1/NCX1 Pathway Regulates Cytoplasmic Ca2+ Homeostasis and Improves Blood Pressure Variability in Hypertension. [Abstract]2023;69(5):603-614. PMID: 36882028 -
Insects
Exendin-4 Caused Growth Arrest by Regulating Sugar Metabolism in Hyphantria cunea (Lepidoptera: Erebidae) Larvae. [Abstract]2024 Jul 5;15(7):503. PMID: 39057236 -
Neurogastroenterol Motil
2019 Feb;31(2):e13482. PMID: 30303298 -
PLoS One
Exendin-4 enhances GLP-1 signaling and reduces anxiety-like behaviors in male heroin withdrawal mice. [Abstract]2026 Mar 12;21(3):e0343995. PMID: 41818251 -
J Mol Histol
Exendin-4 alleviates diabetic retinopathy by activating autophagy via regulation of the adenosine monophosphate-activated protein kinase/sirtuin 1 pathway. [Abstract]2025 Jun 28;56(4):210. PMID: 40580219 -
Diabetol Int
2025 Jun 5;16(3):568-579. PMID: 40607156 -
bioRxiv
Protease-Resistant Azapeptide GLP-1 Analogue Improves Metabolic Control in Diet-Induced Obesity. [Abstract]2025 Nov 18:2025.05.09.653092. PMID: 41278761 -
-
-
-
-
-
bioRxiv
An shRNA screen in primary human beta cells identifies the serotonin 1F receptor as a negative regulator of survival during transplant. [Abstract]2024 May 3:2024.05.01.591950. PMID: 38746433 -
bioRxiv
Incretin hormones and pharmacomimetics rapidly inhibit AgRP neuron activity to suppress appetite. [Abstract]2024 Mar 20:2024.03.18.585583. PMID: 38562891 -
-
-
Lösungsmittel & Löslichkeit
DMSO : 50 mg/mL (11.77 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 25 mg/mL (5.89 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 100 mg/mL (23.55 mM); Clear solution; Need ultrasonic
Protokoll
Rats: 20 Sprague-Dawley male rats, ten of which are treated with exendin-4 (10 μg/kg) and ten of which are used as controls. The study period is 75 days. Serum and pancreatic tissue are removed for biochemical and histological study. Blood glucose, amylase, lipase and adipocytokines are compared between the two groups[5].
Mice: The exendin-4 treatment groups are treated with 10 μg/kg every 24 hours for the first 14 days. This treatment is the induction phase. Respective control mice (lean and ob/ob) receive saline every 24 hours. After 14 days Exendin-4-treated mice are randomly divided into two groups: one group receives high dose exendin-4 (20 μg/kg) every 12 hours, while the second group continues with low dose exendin-4 (10 μg/kg) every 12 hours. The control mice continue to receive saline every 12 hours. The mice are weighed daily for the 60-day treatment period[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Reinheit & Dokumentation
-
Data Sheet (276 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Doyle ME, et al. The importance of the nine-amino acid C-terminal sequence of exendin-4 for binding to the GLP-1 receptor and for biological activity. Regul Pept. 2003 Jul 15;114(2-3):153-8. [Content Brief]
[2]. Wei R, et al. Exenatide exerts direct protective effects on endothelial cells through the AMPK/Akt/eNOS pathway in a GLP-1 receptor-dependent manner. Am J Physiol Endocrinol Metab. 2016 Jun 1;310(11):E947-57. [Content Brief]
[3]. Fidan-YaylalI G, et al. Antidiabetic exendin-4 activates apoptotic pathway and inhibits growth of breast cancer cells. Tumour Biol. 2016 Feb;37(2):2647-53. [Content Brief]
[4]. Ding X, et al. Exendin-4, a glucagon-like protein-1 (GLP-1) receptor agonist, reverses hepatic steatosis in ob/obmice. Hepatology. 2006 Jan;43(1):173-81. [Content Brief]
[5]. Nachnani JS, et al. Biochemical and histological effects of exendin-4 (exenatide) on the rat pancreas. Diabetologia. 2010 Jan;53(1):153-9. [Content Brief]
[6]. Sélley E, et al. Exenatide induces aortic vasodilation increasing hydrogen sulphide, carbon monoxide and nitric oxide production. Cardiovasc Diabetol. 2014 Apr 2;13:69. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2355 mL | 1.1774 mL | 2.3548 mL | 5.8870 mL |
| 5 mM | 0.0471 mL | 0.2355 mL | 0.4710 mL | 1.1774 mL | |
| DMSO | 10 mM | 0.0235 mL | 0.1177 mL | 0.2355 mL | 0.5887 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.