1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor-8 (GDF-8)
  6. GDF-8 Protein, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE GDF-8 Protein, Human/Mouse/Rat (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Background

GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FSTL3, contributing to its regulatory role in modulating skeletal muscle growth.

Biological Activity

1.Determined by its ability to inhibit the proliferation of MPC-11 cells. The ED50 for this effect is 23.3 ng/mL.
2.Immobilized Recombinant Human/Mouse/Rat GDF-8 at 1 μg/mL (100 μL/well) can bind Anti-Human GDF-8 Antibody(TRE_bio, Research Grade). The EC50 of Anti-Human GDF-8 Antibody(TRE_bio, Research Grade) is 1.0-10.0 ng/mL.

  • Determined by its ability to inhibit the proliferation of MPC-11 cells. The ED50 for this effect is 23.3 ng/mL, corresponding to a specific activity is 4.29×104 U/mg.
Species

Mouse; Rat; Human

Source

HEK293

Tag

Tag Free

Accession

O14793 (K262-S375)

Gene ID
Molecular Construction
N-term
GDF-8 (K262-S375)
Accession # O14793
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Growth/differentiation factor 8; GDF-8; Myostatin; MSTN
AA Sequence

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Predicted Molecular Mass
13.1 kDa
분자량

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GDF-8 Protein, Human/Mouse/Rat (HEK293)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GDF-8 Protein, Human/Mouse/Rat (HEK293)
Cat. No.:
HY-P72632
수량:
MCE Japan Authorized Agent: