IGF-I/IGF-1 Protein, Mouse

12 Cited Publications
Customer Review

Based on 12 publication(s) in Google Scholar

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2].

Background

IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival[1][2].

In Vitro

IGF-I/IGF-1 Protein (Mouse; 1 ng/mL; 6 h) can promote the proliferation of thyroid epithelial cells in in vitro mouse thyroid tissues[3].
IGF-I/IGF-1 Protein (Mouse; 10 nM; 1 h) does not affect the level of PKCδ in H9C2 cells[4].

Verified Bioactivity

1.The ED50 is <10 ng/mL as measured by FDC-P1 cells, corresponding to a specific activity of >1 × 105 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is ≤9.923 ng/mL. corresponding to a specific activity is ≥1.007×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 9.164 ng/mL. corresponding to a specific activity is 1.03×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGF1 (G49-A118)
      Accession # P05017-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like

  • AA Sequence

    GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

  • Predicted Molecular Mass

    7.7 kDa

  • Molecular Weight

    Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00