IGF-I/IGF-1 Protein, Mouse

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag^[1][2].

IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival^[1][2].

IGF-I/IGF-1 Protein (Mouse; 1 ng/mL; 6 h) can promote the proliferation of thyroid epithelial cells in in vitro mouse thyroid tissues^[3].
IGF-I/IGF-1 Protein (Mouse; 10 nM; 1 h) does not affect the level of PKCδ in H9C2 cells^[4].

1.The ED₅₀ is <10 ng/mL as measured by FDC-P1 cells, corresponding to a specific activity of >1 × 10⁵ units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is ≤9.923 ng/mL. corresponding to a specific activity is ≥1.007×10⁵ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED₅₀ for this effect is 9.164 ng/mL. corresponding to a specific activity is 1.03×10⁵ units/mg.

Mouse

E. coli

Tag Free

P05017-1 (G49-A118)

16000  [NCBI]

Full Length of Isoform-1 Mature Protein

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mcf7-cell.html  [Content Brief]

  [2]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705.  [Content Brief]

  [3]. Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35(13):1467-1480.  [Content Brief]

  [4]. Tian XJ, et al. Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice. Adv Sci (Weinh). 2024 Feb;11(6):e2305913.  [Content Brief]

  [5]. Pan X, et al. Essential Role Of High Glucose-Induced Overexpression Of PKCβ And PKCδ In GLP-1 Resistance In Rodent Cardiomyocytes. Diabetes Metab Syndr Obes. 2019 Nov 4;12:2289-2302.  [Content Brief]