MIP-3 alpha/CCL20 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MIP-3 alpha/CCL20 Protein, Human is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human  is a recombinant human CCL20 (A27-M96) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MIP-3 alpha/CCL20 Protein, Human is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human  is a recombinant human CCL20 (A27-M96) expressed by E. coli[1].

Background

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation[1][2].

In Vitro

CCL20 (human, 0-50 μg/mL) inhibits B. abortus 2308 with the LD50 (the dose that achieves 50% reduction of CFU) > 50 μg/mL, effects on B. abortus RB51 in a dose-dependent manner with a LD50 of 8.7 μg/mL and demonstrates anti-E. coli activity with a LD50 of 1.5 μg/mL[3].
CCL20 is up-regulated in human colon adenocarcinoma cell lines stimulated by pro-inflammatory cytokines IL-1α and TNF-α and can function as an NF-κB target gene[4].

Verified Bioactivity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10.0-50.0 ng/mL.
2.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is ≤10.35 ng/mL, corresponding to a specific activity is ≥9.662×104 U/mg.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR6. The ED50 for this effect is <2 ng/mL, corresponding to a specific activity is >5×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 9.675 ng/mL, corresponding to a specific activity is 1.034×105 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL20 (A27-M96)
      Accession # P78556-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CCL20; Chemokine (C-C Motif) Ligand 20; Prev. SCYA20; C-C Motif Chemokine 20; LARC; CC Chemokine LARC; MIP-3a; MIP-3-Alpha; ST38; Exodus-1; CKb4; MIP3A; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 20; Beta Chemokine Exodus-1; Liver And Activati

  • AA Sequence

    ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

  • Predicted Molecular Mass

    8 kDa

  • Molecular Weight

    Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00