TGF beta 3/TGFB3 Protein, Human (HEK293)

10 Cited Publications
Customer Review

Based on 10 publication(s) in Google Scholar

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF beta 3/TGFB3 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII)[1][2]. TGF beta 3/TGFB3 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

Background

Three TGF-β isoforms have been found in mammals: TGF-β1, 2, and 3, which are structurally and functionally similar. TGF-β3 is important in embryonic development, scarless repair of injury in the embryo, adult wound healing and tissue homeostasis. It has an important role in regulating cell migration, angiogenesis, epithelial-mesenchymal transition, apoptosis, modulation of immune function, extracellular matrix (ECM) production and the regulation of ECM remodelling; biological processes that are often required for tumour growth and maintenance[1][2].
As with all members of the family, TGF-β3 is highly conserved across species, with mouse, rat and human TGF-β3 demonstrating >97% sequence homology.
TGF-β3 is released from LAP by integrins: integrin-binding results in distortion of the LAP chain and subsequent release of the active TGF-β3. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF-β3 expression increases in fetal wound healing and reduces fibronectin and collagen I and III deposition, and also improves the architecture of the neodermis. Fibroblasts are key cells in the wound healing process. In addition, TGF-β3 may actually play a protective role against tumourigenesis in a range of tissues including the skin, breast, oral and gastric mucosa. TGF-β3 is a more potent inhibitor of DNA synthesis in human keratinocytes compared to TGF-β1 and TGF-β2. TGF-β3 mRNA is expressed in lymphocytes such as CD4+ T cells, CD8+ T cells, γδT cells, and B cells. TGF-β3 has the potential to regulate systemic autoimmune diseases by inhibiting B cells. Moreover, during palatogenesis, TGF-β3 is supposed to transduce signals via both canonical Smad-dependent and non-canonical Smad-independent signaling. In human B cells, TGF-β3 induces phosphorylation of Smad1/5 along with Smad2 and Smad3[1][2][3].
TGF-β3 is involved in cell differentiation, embryogenesis and development. TGF-β3 is crucial in tissue regeneration and scarless tissue repair. TGF-β3 is also involved in palatogenesis, chondrogenesis, and pulmonary development. Furthermore, TGF-β3 plays a role in cancer and immune diseases[1][2][3].

In Vitro

Recombinant TGF-β3 (0.01-10 ng/mL) induces fibronectin expression in leiomyoma cells and directly stimulates leiomyoma cell proliferation[4].
Recombinant TGF-β3 (0.5 ng/mL) promotes mRNA expression, and increased protein levels of osteocalcin (OCN) and type I collagen (COL I) in mouse pulpal mesenchymal cells. TGF-β3 also induces the expression of dentin sialophosphoprotein and dentin matrix protein 1[5].
Recombinant TGF-β3 (0.005-3 ng/mL) adds to rat Sertoli cells cultured in vitro on Matrigel-coated bicameral units perturbed the inter-Sertoli tight junction (TJ) permeability barrier dose-dependently. Moreover, the presence of TGF-β3 also inhibits the transient and/or basal expression of several TJ-associated proteins, which include occludin, zonula occludens-1, and claudin-11 when inter-Sertoli TJs are being assembled in vitro[8].

In Vivo

Recombinant TGF-β3 (1 μg/kg; i.p; once every week) decelerates the progress of radiation-induced pulmonary fibrosis and hindered the recruitment of fibrocytes to lung in radiation-induced mouse pulmonary fibrosis[6].
Recombinant TGF-β3 (local infiltration (0.5 μg, 1.0 μg, 2.5 μg, and 50 μg) or intravenous application (500 μg/kg); for 7 days) treatment accelerates gastric ulcer healing in rats[7].

Verified Bioactivity

1.The ED50 is <0.2 ng/mL as measured in a cell proliferation assay using mouse HT-2 cells.
2.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells. The ED50 for this effect is 10-80 pg/mL.
3.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 10-80 pg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TGFB3 (A301-S412)
      Accession # P10600-1
    • C-term
  • Protein Length

    Full Length of TGFB3 Chain

  • Synonyms

    TGFB3; Transforming Growth Factor, Beta 3; Prev. ARVD1; Transforming Growth Factor Beta; Prev. ARVD; TGF-Beta3; Transforming Growth Factor Beta-3 Proprotein; LDS5; Prepro-Transforming Growth Factor Beta-3; RNHF; Arrhythmogenic Right Ventricular Dysplasia

  • AA Sequence

    ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

  • Predicted Molecular Mass

    12.7 kDa

  • Molecular Weight

    Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Glycine-HCl, 150 mM NaCl, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Mahmoudi Rad M, et al. Expression of TGF-β3 in isolated fibroblasts from foreskin. Rep Biochem Mol Biol. 2015 Apr;3(2):76-81. [Content Brief]

[2]. Laverty HG, et al. TGF-beta3 and cancer: a review. Cytokine Growth Factor Rev. 2009 Aug;20(4):305-17. [Content Brief]

[3]. Toshihiko Komai, et al. Reevaluation of Pluripotent Cytokine TGF-β3 in Immunity. Int J Mol Sci. 2018 Aug 1;19(8):2261. [Content Brief]

[4]. A Arici, et al. Transforming growth factor-beta3 is expressed at high levels in leiomyoma where it stimulates fibronectin expression and cell proliferation. Fertil Steril. 2000 May;73(5):1006-11. [Content Brief]

[5]. Muhetaer Huojia, et al. TGF-beta3 induces ectopic mineralization in fetal mouse dental pulp during tooth germ development. Dev Growth Differ. 2005 Apr;47(3):141-52. [Content Brief]

[6]. Long Xu, et al. Transforming growth factor β3 attenuates the development of radiation-induced pulmonary fibrosis in mice by decreasing fibrocyte recruitment and regulating IFN-γ/IL-4 balance. Immunol Lett. 2014 Nov;162(1 Pt A):27-33. [Content Brief]

[7]. S Coerper, et al. Recombinant human transforming growth factor beta 3 accelerates gastric ulcer healing in rats. Scand J Gastroenterol. 1997 Oct;32(10):985-90. [Content Brief]

[8]. W Y Lui, et al. Transforming growth factor-beta3 perturbs the inter-Sertoli tight junction permeability barrier in vitro possibly mediated via its effects on occludin, zonula occludens-1, and claudin-11. Endocrinology. 2001 May;142(5):1865-77. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00