1. Recombinant Proteins
  2. Others
  3. SHH Protein, Human (C24II)

Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model. SHH Protein, Human (C24II) is a recombinant human SHH protein expressed in E. coli with C24II-mutation and tag-free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human (C24II) is a recombinant human SHH protein expressed in E. coli with C24II-mutation and tag-free.

Background

Sonic Hedgehog (SHH) Protein is a secreted glycoprotein of the Hedgehog family whose transcription is regulated by a long-range regulatory mechanism involving multiple enhancers. The N-terminus of SHH Protein contains a cysteine-rich domain with glycosylation sites and a cholesterol-binding domain at the C-terminus, which can form an N-terminal active fragment (N-SHH) by self-cleavage. In the endoplasmic reticulum, ShhC is degraded, leaving behind the lipidated ShhNp that is essential for developmental patterning. SHH Protein is extensively modified by cleavage and post-translational modifications, and its release from producer cells can also be regulated by interactions with Dispatched, Scube2, and heparan sulfate proteoglycans.
SHH signaling is involved in embryonic development (including lung) and patterning during development. As a ligand of the classic Hedgehog signaling pathway, SHH Protein binds to the transmembrane receptor Frizzled (such as Frizzled-1) and the co-receptor LRP6, activates Smoothened (Smo) and inhibits GSK-3β, relieves β-catenin degradation and causes its nuclear translocation, and activates anti-apoptotic genes such as FOXM1. At the same time, SHH Protein can promote NO release by phosphorylating eNOS through the PI3K/Akt pathway and shorten the action potential duration (APD) of cardiomyocytes. The biological activities of SHH Protein include promoting the maturation of sweat gland cells in three-dimensional culture (upregulating markers such as CK19) and myocardial protection in the pig ischemia-reperfusion model (reducing infarct volume and inhibiting arrhythmias). It is mainly used in the research of tissue engineering (sweat gland regeneration), ischemic diseases (such as myocardial infarction), prostate cancer and other diseases[1][2][3][4][5].

Biological Activity

Measured by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) mouse embryonic fibroblast cells. The ED50 for this effect is <2 μg/mL, corresponding to a specific activity is >500 units/mg.

  • Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 13.31 ng/mL, corresponding to a specific activity is 7.513×103 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15465 (C24-G197, C24II)

Gene ID
Molecular Construction
N-term
SHH (G25-G197, C24II)
Accession # Q15465
C-term
Protein Length

Partial

Synonyms
rHuSonic Hedgehog, C24II; HHG1
AA Sequence

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Predicted Molecular Mass
19.7 kDa
분자량

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

SHH Protein, Human (C24II) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

SHH Protein, Human (C24II)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
SHH Protein, Human (C24II)
Cat. No.:
HY-P7407
수량:
MCE Japan Authorized Agent: