Noggin Protein, Human (HEK293)

Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

Noggin Protein belongs to the bone morphogenetic protein (BMP) antagonist family of the TGF-β superfamily. Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin Protein binds to BMP to form a neutralizing complex, preventing BMP from binding to the receptor, thereby inhibiting BMP signaling and affecting cell survival, proliferation and differentiation^[1]. Noggin Protein can be expressed in human arterial endothelial cells and bone marrow mesenchymal stem cells^[1]. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency^{[1][2][3][4][5]}. Noggin Protein, Human is composed of 232 amino acids, forming a covalently linked homodimer, and has the ability to bind to BMP4 with high affinity.

Noggin Protein, Human (200 ng/mL; 3-21 days) induces alkaline phosphatase activity and mineralization alone or synergistically with inflammatory cytokines/Dexamethasone (HY-14648) in human mesenchymal stem cells (HMSCs), upregulating BMP-2 and ActRII gene expression^[2].

Noggin Protein, Human (0.45-0.9 mg/kg; subcutaneous osmotic pump implantation; 4 weeks) antagonizes BMP4-induced hypertension, vascular NADPH oxidase activation, and endothelial dysfunction in C57BL/6 and apoE^-/- mice^[5].

1.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED₅₀ for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is <10 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is <3 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4.
4.Measured by its ability to inhibit BMP-4 induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is 10-100ng/mL in the presence of 200 ng/mL of Recombinant Human BMP 4.

• 
  Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC₅₀ is 1.523 ng/mL, corresponding to a specific activity of 6.6×10⁵ units/ mg.

Human

HEK293

Tag Free

Q13253 (Q28-C232)

9241  [NCBI]

Full Length of Mature Protein

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23(12):4126-4134.  [Content Brief]

  [2]. Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100(4):824-34.  [Content Brief]

  [3]. Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42(4):425-33.  [Content Brief]

  [4]. Chen C, et al. Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro. J Cell Biochem. 2012 Dec;113(12):3672-80.  [Content Brief]

  [5]. Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25.  [Content Brief]