1. Recombinant Proteins
  2. Noggin Protein, Human (HEK293)

Noggin Protein, Human (HEK293)

Cat. No.: HY-P70558
Handling Instructions

Noggin Protein, Human (HEK293) is a recombinant protein produced by HEK293 cells. Noggin is a potent bone morphogenetic protein (BMP) antagonist capable of inhibiting vasculogenesis even in the presence of provasculogenic VEGF and FGF-2[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $200 In-stock
Estimated Time of Arrival: December 31
50 μg $600 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Noggin; NOG
Species

Human

Source

HEK 293

Accession

Q13253 (Q28-C232)

Gene ID

9241

Molecular Weight

28-30 kDa

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
The ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells has an ED50 value of 0.2 μg/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Noggin is a glycosylated cysteine-knot chemokine protein, which functions as an extracellular negative regulator of transforming growth factor (TGF)β superfamily members. Alongside several other antagonists, Noggin blocks pluripotent bone morphogenetic protein (BMP) signaling that acts locally on target cells, affecting cell survival, proliferation, and differentiation. Noggin inhibits BMPs as a result of forming a neutralizing complex that prevents BMPs from binding to BMP receptor[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Human (HEK293)
Cat. No.:
HY-P70558
Quantity:
MCE Japan Authorized Agent: