Copy Link Print Information

Noggin Protein, Human (HEK293)

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Noggin Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

Background

Noggin Protein belongs to the bone morphogenetic protein (BMP) antagonist family of the TGF-β superfamily. Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin Protein binds to BMP to form a neutralizing complex, preventing BMP from binding to the receptor, thereby inhibiting BMP signaling and affecting cell survival, proliferation and differentiation[1]. Noggin Protein can be expressed in human arterial endothelial cells and bone marrow mesenchymal stem cells[1]. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency[1][2][3][4][5]. Noggin Protein, Human is composed of 232 amino acids, forming a covalently linked homodimer, and has the ability to bind to BMP4 with high affinity.

In Vitro

Noggin Protein, Human (200 ng/mL; 3-21 days) induces alkaline phosphatase activity and mineralization alone or synergistically with inflammatory cytokines/Dexamethasone (HY-14648) in human mesenchymal stem cells (HMSCs), upregulating BMP-2 and ActRII gene expression[2].

In Vivo

Noggin Protein, Human (0.45-0.9 mg/kg; subcutaneous osmotic pump implantation; 4 weeks) antagonizes BMP4-induced hypertension, vascular NADPH oxidase activation, and endothelial dysfunction in C57BL/6 and apoE-/- mice[5].

Verified Bioactivity

1.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED50 for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <10 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <3 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4.
4.Measured by its ability to inhibit BMP-4 induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 10-100ng/mL in the presence of 200 ng/mL of Recombinant Human BMP 4.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q13253 (Q28-C232)

  • Gene ID
    9241  [NCBI]
  • Molecular Construction
    • N-term
    • Noggin (Q28-C232)
      Accession # Q13253
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NOG; Symphalangism 1 (Proximal); Prev. SYNS1; SYNS1A; Prev. SYM1; Noggin; Synostoses (Multiple) Syndrome 1

  • AA Sequence

    QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

  • Predicted Molecular Mass

    23 kDa

  • Molecular Weight

    Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23(12):4126-4134. [Content Brief]

[2]. Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100(4):824-34. [Content Brief]

[3]. Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42(4):425-33. [Content Brief]

[4]. Chen C, et al. Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro. J Cell Biochem. 2012 Dec;113(12):3672-80. [Content Brief]

[5]. Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113(24):2818-25. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC50 is 1.523 ng/mL, corresponding to a specific activity of 6.6×105 units/ mg.

  • 1/16

    Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]

    Customer Validation
     Noggin (0-250 ng/mL; 24 h). CCK8 assay of the cytotoxicity of Noggin on yak PASMCs.

  • 1/16

    Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]

    Customer Validation
     Western blot analysis of the expression levels of BMP signaling pathway-related proteins after treatment with various concentrations of Noggin (100 and 200 ng/mL).

  • 1/16

    Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]

    Customer Validation
     TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.

  • 1/16

    Noggin Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2022 Aug 19;13(1):424. [Abstract]

    Customer Validation
     Noggin (100 ng/mL; 3 days). Phospho-Smad1/5/9, BMP2, COL1A1 and RUNX2 were quantified in hBM-MSCs after 3 days of treatment with AU and/or Noggin by western blot analysis and normalized to GAPDH and tSmad1.

  • Noggin Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Experimental Validation Results for Noggin Protein, Human (HEK293)
  • Noggin Protein, Human (HEK293) Product Image