Kisspeptin-54(human)
Based on 3 publication(s) in Google Scholar
Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) inhibits tumor metastasis and stimulates the secretion of gonadotropin (LH) and testosterone.
For research use only. We do not sell to patients.
- Purity: 99.39%
- CAS No.: 374683-24-6
- Formula: C258H401N79O78
- Molecular Weight:5857.43
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Kisspeptin-54(human)
More
Biological Activity
Description
IC50 & Target
Ki: 1.81 nM (Rat GPR54) and 1.45 nM (Human GPR54)[2]
In Vitro
Kisspeptin-54(human) (1-100 nM, 4-48 h) stimulates aldosterone synthesis in human adrenal cells (H295R cells and fetal adrenal neocortex cells)[3].
Kisspeptin-54(human) (1-10 μM, 12 h) suppresses migration of human pancreatic cancer cells (PANC-1) [4].
Kisspeptin-54(human) (10-1000 nM, 14-16 h for migration, 24-48 h for invasion) inhibits migration and invasion of human renal cell carcinoma cells (Caki-1 and ACHN) with overexpression of metastireceptor[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:PANC-1, AsPC-1
-
Concentration:0.1, 1, and 10 μM
-
Incubation Time:12 h
-
Result:Did not significantly affect the migration of AsPC-1.
Inhibited migration of PANC-1 at 1 and 10 μM.
-
Cell Line:PANC-1, AsPC-1
-
Concentration:0.1, 1, and 10 μM
-
Incubation Time:12 h
-
Result:Did not significantly affect the invasion of the two cell lines.
In Vivo
Kisspeptin-54(human) (0.3-30 nmol/kg, i.p.) produces a dose-dependent effect on c-fos mRNA levels in the anterior pituitary in various ages (PND15, PND30, and PND45) male rats[6].
Kisspeptin-54(human) (0.1-30 nmol/kg, i.p., single) increases serum testosterone in mice, with the same potency as for mouse kisspeptins[7].
Kisspeptin-54(human) (6.7 nmol/rat, s.c.) induces the release of gonadotropin via activation of the hypothalamic GnRH neurons in prepubertal female rats[8].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Post-pubertal male rats[6]
-
Dosage:0.3, 1.0, 3.0, 10, 30 and 100 nmol/kg
-
Administration:Intraperitoneal injection (i.p.), 30 min before trunk blood and anterior pituitaries are collected
-
Result:Elevated c-fos gene expression, as well as the plasma concentrations of LH and testosterone.
Showed no overall statistical effect on plasma testosterone.
Chemical Information
-
CAS No. 374683-24-6
-
Appearance Solid
-
Molecular Weight 5857.43
-
Formula C258H401N79O78
-
Color White to off-white
-
Synonyms
Metastin(human)
-
Sequence
Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
-
Sequence Shortening
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
Jiawei Buzhong Yiqi Decoction attenuates polycystic ovary syndrome through regulating kisspeptin-GPR54-AKT-SHBG system. [Abstract]2024 Oct:133:155931. PMID: 39116604 -
Tissue Cell
Kisspeptin-54 confers renal protection in diabetic nephropathy by ameliorating endothelial permeability through ZEB1 inhibition. [Abstract]2026 Mar 27:101:103503. PMID: 41950743 -
Curr Eye Res
Kisspeptin Suppresses the Growth of Primary Pterygial Cells via Inhibiting Chemokine (C-X-C Motif) Ligands in Microenvironment. [Abstract]2025 Sep;50(9):894-902. PMID: 40555256
Solvent & Solubility
In Vitro:
H2O : 50 mg/mL (8.54 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (301 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. M L Gottsch, et al. A Role for Kisspeptins in the Regulation of Gonadotropin Secretion in the Mouse. Endocrinology. 2004 Sep;145(9):4073-7. [Content Brief]
[2]. M Kotani, et al. The Metastasis Suppressor Gene KiSS-1 Encodes Kisspeptins, the Natural Ligands of the Orphan G Protein-Coupled Receptor GPR54. J Biol Chem. 2001 Sep 14;276(37):34631-6. [Content Brief]
[3]. Nakamura Y, et al. Metastin stimulates aldosterone synthesis in human adrenal cells. Reprod Sci. 2007 Dec;14(8):836-45. [Content Brief]
[4]. Masui T, et al. Metastin and its variant forms suppress migration of pancreatic cancer cells. Biochem Biophys Res Commun. 2004 Feb 27;315(1):85-92. [Content Brief]
[6]. Bentsen AH, et al. Maturation of kisspeptinergic neurons coincides with puberty onset in male rats. Peptides. 2010 Feb;31(2):275-83. [Content Brief]
[7]. Mikkelsen JD, et al. Comparison of the effects of peripherally administered kisspeptins. Regul Pept. 2009 Jan 8;152(1-3):95-100. [Content Brief]
[8]. Matsui H, et al. Peripheral administration of metastin induces marked gonadotropin release and ovulation in the rat. Biochem Biophys Res Commun. 2004 Jul 23;320(2):383-8. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.1707 mL | 0.8536 mL | 1.7072 mL | 4.2681 mL |
| 5 mM | 0.0341 mL | 0.1707 mL | 0.3414 mL | 0.8536 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.