Murine cardiac troponin I peptide TFA
Based on 1 Customer Validation
Murine cardiac troponin I peptide TFA (Murine cardiac TnI peptide TFA) is a murine cardiac troponin I (cTnI) peptide. Murine cardiac troponin I peptide TFA can induce significant myocardial inflammation followed by fibrosis and heart failure with increased mortality in mice model. Murine cardiac troponin I peptide TFA can be used for heart failure research.
For research use only. We do not sell to patients.
- Purity : 98.11%
- Formula: C262H439N81O78.xC2HF3O2
- Molecular Weight:5971.78 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Induced Disease Models
Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.
Administration: Murine cardiac TnI peptide (250 μg, emulsified in complete Freund's adjuvant (CFA) (HY-153808)), subcutaneous (s.c.) immunization on day 0 and day 7 • anti‑mouse PD‑1 antibody (5‑10 mg/kg), intraperitoneal (i.p.) injection every 2 days for total 5 doses starting from day 7/8
(2) Anti-PD-1 dose and start day differ slightly between protocols (5 mg/kg from day 7[3]; 10 mg/kg from day 8[2]); dose titration recommended.
Serum myocardial injury markers: Elevated CK, elevated CK‑MB, elevated LDH‑1, elevated cTnI, elevated cTnT
Histology analysis: Myocardial inflammatory infiltration, cardiomyocyte necrosis, interstitial fibrosis; detected by H&E, Masson's trichrome, Sirius Red staining
Molecular changes: Elevated NLRP3, cleaved caspase‑1, cleaved GSDMD, IL‑1β, IL‑18 in heart tissue; activated NF‑κB pathway with elevated p‑p65, elevated p‑IκBα, elevated p65 DNA‑binding activity; reduced HIF‑1 mRNA
Survival: Significantly increased mortality compared with vehicle group
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 5971.78 (free base)
-
Formula C262H439N81O78.xC2HF3O2
-
Color White to off-white
-
Synonyms
Murine cardiac TnI peptide TFA
-
Sequence
His-Ala-Arg-Val-Asp-Lys-Val-Asp-Glu-Glu-Arg-Tyr-Asp-Val-Glu-Ala-Lys-Val-Thr-Lys-Asn-Ile-Thr-Glu-Ile-Ala-Asp-Leu-Thr-Gln-Lys-Ile-Tyr-Asp-Leu-Arg-Gly-Lys-Phe-Lys-Arg-Pro-Thr-Leu-Arg-Arg-Val-Arg-Ile-Ser
-
Sequence Shortening
HARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRIS
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : ≥ 50 mg/mL
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (316 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Murine cardiac troponin I peptide TFA Related Classifications
HY-P11206A Related Classifications
Powered by Bioz