1. Induced Disease Models Products
  2. Immunology and Inflammatory Disease Models
  3. Myocarditis Models
  4. Murine cardiac troponin I peptide

Murine cardiac troponin I peptide  (Synonyms: Murine cardiac TnI peptide)

Cat. No.: HY-P11206
Handling Instructions Technical Support

Murine cardiac troponin I peptide (Murine cardiac TnI peptide) is a murine cardiac troponin I (cTnI) peptide. Murine cardiac troponin I peptide can induce significant myocardial inflammation followed by fibrosis and heart failure with increased mortality in mice model. Murine cardiac troponin I peptide can be used for heart failure research.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Murine cardiac troponin I peptide

Murine cardiac troponin I peptide 화학구조

사이즈 재고
50 mg   견적 받기  
100 mg   견적 받기  
250 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Murine cardiac troponin I peptide:

Other Forms of Murine cardiac troponin I peptide:

Top Publications Citing Use of Products
  • Biological Activity

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

Murine cardiac troponin I peptide (Murine cardiac TnI peptide) is a murine cardiac troponin I (cTnI) peptide. Murine cardiac troponin I peptide can induce significant myocardial inflammation followed by fibrosis and heart failure with increased mortality in mice model. Murine cardiac troponin I peptide can be used for heart failure research[1].

분자량

5971.78

화학식

C262H439N81O78

Sequence

His-Ala-Arg-Val-Asp-Lys-Val-Asp-Glu-Glu-Arg-Tyr-Asp-Val-Glu-Ala-Lys-Val-Thr-Lys-Asn-Ile-Thr-Glu-Ile-Ala-Asp-Leu-Thr-Gln-Lys-Ile-Tyr-Asp-Leu-Arg-Gly-Lys-Phe-Lys-Arg-Pro-Thr-Leu-Arg-Arg-Val-Arg-Ile-Ser

Sequence Shortening

HARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRIS

SMILES

O=C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC1=CC=C(C=C1)O)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N4[C@@H](CCC4)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CO)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC5=CNC=N5)N

선적

Room temperature in continental US; may vary elsewhere.

보관

Please store the product under the recommended conditions in the Certificate of Analysis.

순도&문서
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • 몰농도 계산기

  • 농도 희석 계산기

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Murine cardiac troponin I peptide
Cat. No.:
HY-P11206
수량:
MCE Japan Authorized Agent: