country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11206

Copy Link Print Information

Murine cardiac troponin I peptide

Name: Murine cardiac troponin I peptide
Brand: MedChemExpress
SKU: HY-P11206
Availability: PreOrder

(Synonyms: Murine cardiac TnI peptide)

Murine cardiac troponin I peptide (Murine cardiac TnI peptide) is a murine cardiac troponin I (cTnI) peptide. Murine cardiac troponin I peptide can induce significant myocardial inflammation followed by fibrosis and heart failure with increased mortality in mice model. Murine cardiac troponin I peptide can be used for heart failure research.

For research use only. We do not sell to patients.

Formula: C₂₆₂H₄₃₉N₈₁O₇₈
Molecular Weight:5971.78

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Data Sheet (313 KB)

Murine cardiac troponin I peptide Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- In Vivo
- Induced Disease Models
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

In Vivo

Murine cardiac troponin I peptide (250 μg; subcutaneous injection; day 0 and day 7) combined with anti‑mouse PD‑1 antibody induces immune checkpoint inhibitors‑related myocarditis, presenting myocardial inflammatory infiltration, fibrosis, impaired cardiac contractile function, elevated myocardial injury biomarkers, cardiomyocyte pyroptosis and disordered HIF‑1 signaling‑related gene expression in BALB/c mice^[2]^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Induced Disease Models

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

Induction of Myocarditis^[2]^[3]

Background

Murine cardiac troponin I peptide contains an immunodominant epitope shared between the myocardium and tumors. Immunization with this peptide activates cTnI‑specific autoreactive CD4⁺/CD8⁺ T cells; administration of an anti‑mouse programmed death 1 (PD‑1) antibody blocks the PD‑1/PD‑L1 immune checkpoint, breaks peripheral immune tolerance, and promotes clonal expansion and myocardial infiltration of these autoreactive T cells. The resultant autoimmune attack drives NLRP3 inflammasome activation and cardiomyocyte pyroptosis, triggering myocarditis, myocardial fibrosis, contractile dysfunction, and eventual heart failure^[2]^[3].

Specific Modeling Methods

Mice: Male • BALB/c mice • 6 weeks old • 20-25 g
Administration: Murine cardiac TnI peptide (250 μg, emulsified in complete Freund's adjuvant (CFA) (HY-153808)), subcutaneous (s.c.) immunization on day 0 and day 7 • anti‑mouse PD‑1 antibody (5‑10 mg/kg), intraperitoneal (i.p.) injection every 2 days for total 5 doses starting from day 7/8

Note

(1) Murine cardiac troponin I peptide is emulsified 1:1 in complete Freund's adjuvant (CFA) prior to s.c. injection to ensure effective antigen presentation.
(2) Anti-PD-1 dose and start day differ slightly between protocols (5 mg/kg from day 7^[3]; 10 mg/kg from day 8^[2]); dose titration recommended.

Modeling Indicators

Cardiac function (echocardiography, day 21): Decreased LVEF, decreased FS, thickened systolic and diastolic LVAW
Serum myocardial injury markers: Elevated CK, elevated CK‑MB, elevated LDH‑1, elevated cTnI, elevated cTnT
Histology analysis: Myocardial inflammatory infiltration, cardiomyocyte necrosis, interstitial fibrosis; detected by H&E, Masson's trichrome, Sirius Red staining
Molecular changes: Elevated NLRP3, cleaved caspase‑1, cleaved GSDMD, IL‑1β, IL‑18 in heart tissue; activated NF‑κB pathway with elevated p‑p65, elevated p‑IκBα, elevated p65 DNA‑binding activity; reduced HIF‑1 mRNA
Survival: Significantly increased mortality compared with vehicle group

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

Molecular Weight 5971.78
Formula C₂₆₂H₄₃₉N₈₁O₇₈
SMILES

O=C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC1=CC=C(C=C1)O)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N4[C@@H](CCC4)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CO)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC5=CNC=N5)N
Synonyms

Murine cardiac TnI peptide
Sequence

His-Ala-Arg-Val-Asp-Lys-Val-Asp-Glu-Glu-Arg-Tyr-Asp-Val-Glu-Ala-Lys-Val-Thr-Lys-Asn-Ile-Thr-Glu-Ile-Ala-Asp-Leu-Thr-Gln-Lys-Ile-Tyr-Asp-Leu-Arg-Gly-Lys-Phe-Lys-Arg-Pro-Thr-Leu-Arg-Arg-Val-Arg-Ile-Ser
Sequence Shortening

HARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRIS
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (313 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Kaya Z, et al. Identification of cardiac troponin I sequence motifs leading to heart failure by induction of myocardial inflammation and fibrosis. Circulation. 2008 Nov 11;118(20):2063-72. [Content Brief]

[2]. Cao B, et al. Protective Effect of Xihuang Pill on Immune Checkpoint Inhibitors‑Related Myocarditis in a Mouse Model by Regulating the HIF‑1 Signaling Pathway. Journal of Inflammation Research, 2025, 18: 15511‑15525.

[3]. Zhang H, et al. Protective Effect of Crocin on Immune Checkpoint Inhibitors-Related Myocarditis Through Inhibiting NLRP3 Mediated Pyroptosis in Cardiomyocytes via NF-κB Pathway. J Inflamm Res. 2022 Mar 5;15:1653-1666.

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote