Copy Link Print Information

Animal-Free FGF-20 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FGF-20 protein, a homodimer, functions as a neurotrophic factor essential for regulating central nervous system development and function.It interacts with specific receptors, FGFR2 and FGFR4, with heparan sulfate glycosaminoglycans enhancing the binding affinity between fibroblast growth factors (FGFs) and their receptors, serving as coreceptors in this intricate signaling process.Animal-Free FGF-20 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-20 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free FGF-20 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-20 protein, a homodimer, functions as a neurotrophic factor essential for regulating central nervous system development and function.It interacts with specific receptors, FGFR2 and FGFR4, with heparan sulfate glycosaminoglycans enhancing the binding affinity between fibroblast growth factors (FGFs) and their receptors, serving as coreceptors in this intricate signaling process.Animal-Free FGF-20 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-20 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

FGF-20 protein serves as a neurotrophic factor crucial for the regulation of central nervous system development and function. Operating as a homodimer, it interacts with specific receptors, namely FGFR2 and FGFR4. The binding affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by heparan sulfate glycosaminoglycans, acting as coreceptors in this intricate signaling process.

Verified Bioactivity

The ED50 is 1.3-3.2 ng/mL as measure by its ability to induce 3T3 cells proliferation, corresponding to a specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q9NP95 (P3-T211)

  • Gene ID
    26281  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-20 (P3-T211)
      Accession # Q9NP95
    • 6*His
    • C-term
  • Protein Length

    Full Length of Fibroblast growth factor 20 Chain

  • Synonyms

    FGF20; FGF20 Protein; Fibroblast Growth Factor 20; RHDA2; FGF-20; FGF; Fibroblast Growth Factor

  • AA Sequence

    PLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

  • Predicted Molecular Mass

    24.2 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free FGF-20 Protein, Human (His) Product Image
    1/16
  • Animal-Free FGF-20 Protein, Human (His) Product Image