1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Animal-Free SCF Protein, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

Background

The stem cell factor (SCF) protein serves as a ligand for the receptor-type protein-tyrosine kinase KIT, playing a crucial role in the regulation of various cellular processes. Its functions encompass the control of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding with KIT, SCF activates multiple signaling pathways, including the phosphorylation of PIK3R1 and subsequent activation of AKT1. The interaction also triggers signaling cascades involving GRB2, RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Furthermore, SCF and KIT promote the activation of STAT family members (STAT1, STAT3, and STAT5), as well as PLCG1, leading to the production of diacylglycerol and inositol 1,4,5-trisphosphate as cellular signaling molecules. Acting synergistically with other cytokines, likely interleukins, SCF forms a homodimer non-covalently linked and a heterotetramer with KIT, facilitating KIT dimerization and subsequent activation through autophosphorylation.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P20826 (K26-A189)

Gene ID

17311

Molecular Construction
N-term
SCF (K26-A189)
Accession # P20826
C-term
Protein Length

Full Length of Soluble KIT ligand

Synonyms
Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF
AA Sequence

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Predicted Molecular Mass
18.4 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Animal-Free SCF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Animal-Free SCF Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free SCF Protein, Mouse
Cat. No.:
HY-P70528AF
Quantity:
MCE Japan Authorized Agent: