Beta-NGF Protein, Mouse (110a.a)

Customer Review

Based on 1 Customer Validation

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss. Beta-NGF Protein, Mouse is produced by E.coli (M130-R239), with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse is produced by E.coli (M130-R239), with tag free.

Background

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

In Vitro

NGF (mouse; 4 ng/mL; 24 h) IL-6 production is induced and ALP activity and collagen biosynthesis are enhanced without affecting cell proliferation in osteoblast MC3T3-E1[4].

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is <200 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Beta-NGF (M130-R239)
      Accession # P01139
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NGF; Beta-NGF; Prev. NGFB; Pro-Nerve Growth Factor Long; Beta-Nerve Growth Factor; HSAN5; Nerve Growth Factor (Beta Polypeptide); Nerve Growth Factor; Nerve Growth Factor, Beta Subunit

  • AA Sequence

    MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

  • Predicted Molecular Mass

    12.4 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 200 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 200 mM NaCl, pH 8.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00