Copy Link Print Information

Beta-NGF Protein, Mouse (CHO)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss. Beta-NGF Protein, Mouse (CHO) is produced by CHO cells (S122-G241), with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Beta-NGF Protein, Mouse (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse (CHO) is produced by CHO cells (S122-G241), with tag free.

Background

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

In Vitro

NGF (mouse; 4 ng/mL; 24 h) IL-6 production is induced and ALP activity and collagen biosynthesis are enhanced without affecting cell proliferation in osteoblast MC3T3-E1[4].

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is 1-8 ng/mL.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession

    P01139 (S122-G241)

  • Gene ID
    18049  [NCBI]
  • Molecular Construction
    • N-term
    • Beta-NGF (S122-G241)
      Accession # P01139
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NGF; Beta-NGF; Prev. NGFB; Pro-Nerve Growth Factor Long; Beta-Nerve Growth Factor; HSAN5; Nerve Growth Factor (Beta Polypeptide); Nerve Growth Factor; Nerve Growth Factor, Beta Subunit

  • AA Sequence

    SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

  • Predicted Molecular Mass

    13.5 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 150 mM NaCl, 50 mM NaAc, pH 5.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26(153):717-722. [Content Brief]

[2]. Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62(1):67-72. [Content Brief]

[3]. Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293. [Content Brief]

[4]. Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205(2):1187-93. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    Customer Validation
     Cell viability of the MC3T3-E1 cells incubated with NGF (Beta-NGF Protein; 50-150 ng/mL) for 24 h. The safe concentrations of NGF (0-150 ng/mL) within 24 h were determined by MTT assay.

  • 1/16

    Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    Customer Validation
     ALP and ARS staining of MC3T3-E1 cells treated with NGF (Beta-NGF Protein; 50-100 ng/mL; Every 2-3 days for 7-day ALP staining, 21 days for ARS staining). The results of ARS staining were consistent with those of ALP staining, showing that 100 ng/mL of NGF enhanced bone mineralization most effectively.

  • 1/16

    Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    Customer Validation
     ALP activity of MC3T3-E1 cells treated with NGF (Beta-NGF Protein; 50-100 ng/mL; Every 2-3 days for 7 days). ALP activity assay revealed that NGF promoted the secretion of ALP in MC3T3-E1 cells, with the most significant effect at the concentration of 100 ng/mL.

  • 1/16

    Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    Customer Validation
     NGF (Beta-NGF Protein; 10 μg/kg; i.v. (tail vein); every 2 days for 6 weeks). H&E, Masson and Trap staining of tibia tissue.

  • 1/16

    Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: J Trace Elem Med Biol. 2025 Aug:90:127694. [Abstract]

    Customer Validation
     Histopathological view of liver tissue: a. Control group, b. NGF (Beta-NGF Protein; 10 µg/kg; i.p.; once daily for 3 days) group, c. p38MAPKi group, d. NGF+p38MAPKi group, e. Cu group, f. Cu+NGF group, g. Cu+p38MAPKi group, h. Cu+NGF+p38MAPKi group. While the liver tissue of non-Cu-treated groups appears histomorphologically normal, hydropic degeneration (arrow) and hepatocellular necrosis (arrow head) are evident in Cu-treated groups. HE.

  • Beta-NGF Protein, Mouse (CHO) Product Image
    1/16
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Experimental Validation Results for Beta-NGF Protein, Mouse (CHO)
  • Beta-NGF Protein, Mouse (CHO) Product Image

  • Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    Cell viability of the MC3T3-E1 cells incubated with NGF (Beta-NGF Protein; 50-150 ng/mL) for 24 h. The safe concentrations of NGF (0-150 ng/mL) within 24 h were determined by MTT assay.

  • Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    ALP and ARS staining of MC3T3-E1 cells treated with NGF (Beta-NGF Protein; 50-100 ng/mL; Every 2-3 days for 7-day ALP staining, 21 days for ARS staining). The results of ARS staining were consistent with those of ALP staining, showing that 100 ng/mL of NGF enhanced bone mineralization most effectively.

  • Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    ALP activity of MC3T3-E1 cells treated with NGF (Beta-NGF Protein; 50-100 ng/mL; Every 2-3 days for 7 days). ALP activity assay revealed that NGF promoted the secretion of ALP in MC3T3-E1 cells, with the most significant effect at the concentration of 100 ng/mL.

  • Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 May 22:32:101898. [Abstract]

    NGF (Beta-NGF Protein; 10 μg/kg; i.v. (tail vein); every 2 days for 6 weeks). H&E, Masson and Trap staining of tibia tissue.

  • Beta-NGF Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: J Trace Elem Med Biol. 2025 Aug:90:127694. [Abstract]

    Histopathological view of liver tissue: a. Control group, b. NGF (Beta-NGF Protein; 10 µg/kg; i.p.; once daily for 3 days) group, c. p38MAPKi group, d. NGF+p38MAPKi group, e. Cu group, f. Cu+NGF group, g. Cu+p38MAPKi group, h. Cu+NGF+p38MAPKi group. While the liver tissue of non-Cu-treated groups appears histomorphologically normal, hydropic degeneration (arrow) and hepatocellular necrosis (arrow head) are evident in Cu-treated groups. HE.