Beta-NGF Protein, Human (CHO)
Based on 5 publication(s) in Google Scholar
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.
Background
Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.
In Vitro
NGF (human; 1 ng/mL; 5 d) induces a dose-dependent increase in DNA synthesis of B cells[4].
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.2-2 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
Bioact Mater
A biomimetic piezoelectric scaffold with sustained Mg2+ release promotes neurogenic and angiogenic differentiation for enhanced bone regeneration. [Abstract]2022 Nov 29:25:399-414. PMID: 37056250 -
-
Acta Biomater
Multifunctional annulus fibrosus matrix prevents disc-related pain via inhibiting neuroinflammation and sensitization. [Abstract]2023 Oct 15:170:288-302. PMID: 37598791 -
Polymers
Silk Fibroin Hydrogel Microneedles Loaded with Recombinant Human Nerve Growth Factor for Corneal Tissue Engineering. [Abstract]2026 Feb 5;18(3):412. PMID: 41682118 -
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
P01138 (S122-R239)
-
Molecular Construction
-
N-term
-
Beta-NGF (S122-R239)
Accession # P01138 -
C-term
-
-
Protein Length
Full Length of Beta-nerve growth factor Chain
-
Synonyms
NGF; Beta-NGF; Prev. NGFB; Pro-Nerve Growth Factor Long; Beta-Nerve Growth Factor; HSAN5; Nerve Growth Factor (Beta Polypeptide); Nerve Growth Factor; Nerve Growth Factor, Beta Subunit
-
AA Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
-
Predicted Molecular Mass
13.2 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 40 mM His, 40 mM Arg, 150 mM NaCl, pH 5.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM NaAC, 150 mM NaCl, pH 5.5, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26(153):717-722. [Content Brief]
[2]. Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62(1):67-72. [Content Brief]
[3]. Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293. [Content Brief]
[4]. Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86(24):10059-63. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)