1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Nerve Growth Factor-β (Beta-NGF)
  6. Beta-NGF Protein, Human (CHO)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.

Background

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

In Vitro

NGF (human; 1 ng/mL; 5 d) induces a dose-dependent increase in DNA synthesis of B cells[4].

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.2-2 ng/mL.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.6768 ng/mL, corresponding to a specific activity is 1.478×106 units/mg.
Species

Human

Source

CHO

Tag

Tag Free

Accession

P01138 (S122-R239)

Gene ID
Molecular Construction
N-term
Beta-NGF (S122-R239)
Accession # P01138
C-term
Protein Length

Partial

Synonyms
Beta-NGF; Beta-Nerve Growth Factor; NGF; NGFB
AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Predicted Molecular Mass
13.2 kDa
Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Homodimer
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 40 mM His, 40 mM Arg, 150 mM NaCl, pH 5.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM NaAC, 150 mM NaCl, pH 5.5, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Beta-NGF Protein, Human (CHO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beta-NGF Protein, Human (CHO)
Cat. No.:
HY-P73316
Quantity:
MCE Japan Authorized Agent: