1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc)

4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc)

Cat. No.: HY-P74335
Handling Instructions Technical Support

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells. Mouse 4-1BB protein is a surface glycoprotein with a transmembrane domain (188-208 a.a.). 4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc) has 188 amino acids (V24-L211), produced by HEK293 cells with C-terminal rFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Mouse 4-1BB protein is a surface glycoprotein with a transmembrane domain (188-208 a.a.). 4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc) has 188 amino acids (V24-L211), produced by HEK293 cells with C-terminal rFc-tag.

Background

4-1BB, is encoded by TNFRSF9 (CD137, ILA), belongs to tumor necrosis factor (TNF) receptor superfamily. 4-1BB is a surface glycoprotein, expressed in a variety of cells, for example, T cells, B cells, natural killer (NK) cells, dendritic (DCs), eosinophils, and mast cells; even a variety of tumor cells such as human leukemia cells. It is widely spread in vascular smooth muscles, tumor vessel walls, and liver tissue of hepatocellular carcinoma. 4-1BB has a preference on CD8+ cells rather than CD4+ cells. It provides co-stimulatory signals and activates cytotoxic effects of CD8+ T cells and helps to form memory T cells. Finally, it promotes the immune system fighting against tumors. Moreover, CD137 binds CD137L to signal monocytes, increase their survival, proliferation and stimulate their migration and extravasation. In addition, it induces the release of various proinflammatory factors, leads to the influx of inflammatory monocytes into tissues and form an inflammatory environment[1]. Specifically, CD137 promotes the migration of monocytes/macrophages to tumor microenvironment by upregulating the expression of Fra1. It also promoted the differentiation of monocytes/macrophages into osteoclasts at the same time, thus providing a favorable microenvironment for the colonization and growth of breast cancer cells in bone. It provides a promising therapeutic strategy for metastasis of breast cancer[2]. Furthermore, CD137 signaling promotes endothelial cells (ECs) apoptosis through prooxidative and proinflammatory mechanisms, mediated by Nrf2 and NF-κB pathways, respectively[3]. The homology of 4-1BB protein in human and mouse was low, and the sequence similarity was 56.75%.

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Species

Mouse

Source

HEK293

Tag

C-rFc

Accession

NP_001070976 (V24-L211)

Gene ID
Molecular Construction
N-term
4-1BB (V24-L211)
Accession # NP_001070976
rFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137
AA Sequence

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Predicted Molecular Mass
46.1 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, Fc)
Cat. No.:
HY-P74335
Quantity:
MCE Japan Authorized Agent: